Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "future"

1. All these years, I have been grateful for the journey and excited for what the future holds.

2. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

3. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

4. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

5. Environmental protection requires a long-term vision and commitment to future generations.

6. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

7. I am absolutely excited about the future possibilities.

8. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

9. It's important to maintain a good credit score for future financial opportunities.

10. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

11. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

12. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

13. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

14. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

15. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

16. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

17. Promise babayaran kita in the future. sabi ko sa kanya.

18. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

19. Supporting policies that promote environmental protection can help create a more sustainable future.

20. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

21. The uncertainty of the future can cause anxiety and stress.

22. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

23. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

Random Sentences

1. Tumango tapos nag punta na kami sa may garden ng hospital.

2. He is taking a photography class.

3. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

4. "Kapag may tiyaga, may nilaga" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pasensya at pagsisikap upang makamit ang tagumpay.

5. Hinawakan ko siya sa may balikat niya.

6. Using the special pronoun Kita

7. Nauntog si Jerome sa kanilang pintuan.

8. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

9. Wala nang iba pang mas mahalaga.

10. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

11. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

12. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

13. He has been practicing yoga for years.

14. All these years, I have been working to make a positive impact on the world.

15. Football is played with two teams of 11 players each, including one goalkeeper.

16. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

17. Madilim ang kweba na kanilang pinasok.

18. The sun is setting in the sky.

19. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

20. Si Aling Juana ang tagalaba ng pamilya.

21. El nacimiento puede ser un momento de alegría y emoción para la familia, pero también puede ser estresante y desafiante.

22. Nagpabakuna kana ba?

23. May isa pang nagpapaigib sa kanya.

24. Hindi na maawat ang panaghoy ng matanda nang makita ang nasirang bahay.

25. Walang nakakaalam kung saan sila napupunta.

26. Technology has also had a significant impact on the way we work

27. Sa gitna ng buhawi, ang makabagong teknolohiya tulad ng Doppler radar ay ginagamit upang masubaybayan at maipabatid ang lakas at direksyon nito.

28. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

29. Ang mahal pala ng ticket papuntang Amerika!

30. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

31. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

32. Oscilloscopes display voltage as a function of time on a graphical screen.

33. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

34. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

35. Pero gusto ko nang umuwi at magpahinga.

36. Today is my birthday!

37. Ano ang kulay ng paalis nang bus?

38. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

39. Ang kahulugan ng duli ay tinik pagka't siya ay laging nagbibigay ng ligalig sa kanyang mga kaaway.

40. He has been hiking in the mountains for two days.

41. Magtatanim kami ng mga puno sa isang linggo.

42. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

43. Remember that the most important thing is to get your ideas and message out to the world

44. Wala kang pakelam! O sige its my turn na!

45. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

46. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

47. Ano bang nangyari? tanong ni Lana.

48. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

49. Anong pinag-usapan niyo ni Mommy? biglang tanong ni Maico.

50. Mabilis na tumatakbo ang kotse papunta sa kaniyang opisina.

Recent Searches

futuresetshighestcleanpasinghalnakayukomapapapagpalitmulighederboracaysino-sinoh-hoymaitimnagtatanghalianannikaseryosomonsignordetdasalputingmatikmansatisfactionpinapalobeautifullintanahigitankasalukuyanpotaenaagricultoreskawili-wilimurang-muranakakapamasyalgumagalaw-galawkumukuhaeconomypagkaimpaktonanahimiknagtatamponag-iinomkinauupuangpamanhikanmakangitimakakasahodspiritualmang-aawitnagmamaktolimaginglikelyendcouldoverviewemphasisbulalayout,grabenagingcomuneshariwealthhampaslupanaghuhumindigmagpakasalpagkalitonagpuyosmakalipasinilalabaskarunungantreatseskuwelakumikinigmabihisantanggalinnaapektuhanpagkatakotpambahaykasintahankaharianmagtiwalapagtataaspamilihanmangkukulamsasamahannagtataelalabasnakabibingingmagagamitnalamankinalilibinganpagamutantahimikkayabanganmagalanginaamintsismosakailanmaninstrumentalnalangipinauutangnabigyangawaingtinahakusuariokakilalaginawaransapatoscnicoaddictionathenatinitindanatagalanbilanginiyakkendikasuutanmaayosmanilajennytelecomunicacioneskoreaunangnuevoseroplanocantidadpakilagaytindahannatutulogmaynilapapayanagbibigayannasunognakakatabamakabalikligaliglubosbibilimahigpitbumagsakkumaenabigaelmasukoldakilangkatibayangumabotkauntiisinumpapulitikonochebeseskainisanumancampaignstondonapadaanbopolscandidateslaamangearningnicomangenapatinginpatunayanmarmaingmeansgiverkinantasitawknightnahigaiconsdipanglalapalagitillkikomalayang1954seniorbotantelarosinumangkapatidburmafurmodernesenatetaingakaboseslaryngitismerryfonosnakasuotmedidapunsopakain1980lamesapshnilinispeepsabihing