Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "future"

1. All these years, I have been grateful for the journey and excited for what the future holds.

2. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

3. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

4. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

5. Environmental protection requires a long-term vision and commitment to future generations.

6. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

7. I am absolutely excited about the future possibilities.

8. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

9. It's important to maintain a good credit score for future financial opportunities.

10. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

11. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

12. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

13. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

14. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

15. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

16. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

17. Promise babayaran kita in the future. sabi ko sa kanya.

18. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

19. Supporting policies that promote environmental protection can help create a more sustainable future.

20. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

21. The uncertainty of the future can cause anxiety and stress.

22. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

23. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

Random Sentences

1. They walk to the park every day.

2. Wala pa ba? seryoso niyang tanong.

3. Me gusta mucho dibujar y pintar como pasatiempo.

4. Simula noon ang batang si Amba ay naging unang gagamba.

5. Na-suway ang driver ng tricycle nang lumabag ito sa batas trapiko.

6. Las escuelas también pueden ser religiosas o seculares.

7. May sinasabi ka ba? umiling ako sa tanong ni Kenji

8. Ang mga punong-kahoy ay kinikilala rin bilang mga tagapagligtas ng ating planeta dahil sa kanilang kakayahan sa pag-absorb ng carbon dioxide.

9. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

10. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

11. Tuwang tuwa ang mga tao dahil magaganda ang kanilang ani.

12. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

13. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

14. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

15. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

16. Laganap ang paggamit ng social media sa kabataan ngayon.

17. Isang araw, may nanghingi ng kanyang ilang pananim.

18. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

19. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

20. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

21. Don't put all your eggs in one basket

22. Si Anna ay maganda.

23. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

24. Parang gusto ko nang magka-baby. pagkuwan eh sabi niya.

25. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

26. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

27. Nous avons embauché un DJ pour animer notre soirée de mariage.

28. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

29. Saya suka musik. - I like music.

30. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

31. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

32. Uno de mis pasatiempos favoritos es leer novelas de misterio.

33. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

34. Alt i alt er den danske økonomi kendt for sin høje grad af velstand og velfærd, og dette skyldes en kombination af markedsøkonomi og offentlig regulering, eksport, offentlig velfærd og økologisk bæredygtighed

35. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

36. Limitations can be addressed through education, advocacy, and policy changes.

37. Don't give up - just hang in there a little longer.

38. Ang lilim ng kanyang mga braso ay nagbigay ng komportableng yakap sa kanyang mga apo.

39. Hindi ko alam kung bakit hindi ka pa rin nakakapag-move on sa kahit anong nangyari.

40. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

41. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

42. Humayo ka at hanapin mo ang dalagang sinasabi ko para mabalik ang dati mong anyo, ang utos ng engkantadang babae.

43. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

44. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

45. Pumunta ako sa Laguna noong Sabado.

46. Les patients peuvent bénéficier de programmes de réadaptation pendant leur hospitalisation.

47. Ginamot sya ng albularyo.

48. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

49. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

50. Ayos lang. Basta alam kong safe kang nakauwi.

Recent Searches

dialledfuturemanilavelfungerendenasundosumagotnoomakesmadalasnagpagawatermtapusinyayaexplainlenguajelumusobbeyondmanonoodlulusognagdarasalconstitutionlegendsambitwowligapinapagulongvidenskabenpaglakidraft,waterpalakolstatingnangyayariumibigwalang-tiyaknyabawalmalinissigedisyembreusobagkus,kanilaseryosongnagtungobabasahinusedadditionally,tambayannegro-slavesnoongpanitikan,patichesskendisasagutinmakapilingsasapakinumiyaktoothbrushukol-kayibinigayuniversitiestibigroselleibonnungpangkatmaaarimaghahatidcurtainsyumuyukosiniyasatmagbabalatumaposnagbantaypinagkasundoginagawaprovidedmagsusuotsumalaboyetfeelingkubomagisiplabinsiyampalibhasaadvertising,twinkleipasokmahihirapuseminu-minutograduallykakayananmapdawdoktorrocktumatawadkamakailanlaamangarbejdsstyrkeindividualkuwadernomensajesnakasakitnakaangattinataluntonimpentulognakatagonegrospinisilgreatartekilongreserbasyongobernadornagtutulungananjoflamencoinstrumentalsitawnabighanitsealbularyomaariapatnapulamantokyojulietjunelargespecializedcandidatenabuhaypyestaalmacenarwaitbaguiodonenag-umpisaniyogtoolbantulotprobinsyaenergy-coaltodotakepatientnakikilalangriegamakapangyarihannagc-cravecakepuwedepagpapatubomakapangyarihangkalakimitigatebinasakapwatmicapulubiseniorexpertisetahimikcomplicateddayinainteriornakalilipaspanghihiyangganyanbirthdaypakanta-kantangosakaaddressnaiilangmag-uusapthenformsmaranasantingsharmainehinabolmalllungsodinilistakumbinsihintumakastabasnaguguluhanisinaboymagagandanggabibanalimportantesnapatayo