Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "future"

1. All these years, I have been grateful for the journey and excited for what the future holds.

2. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

3. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

4. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

5. Environmental protection requires a long-term vision and commitment to future generations.

6. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

7. I am absolutely excited about the future possibilities.

8. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

9. It's important to maintain a good credit score for future financial opportunities.

10. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

11. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

12. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

13. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

14. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

15. Los sueños son la manifestación de nuestra creatividad y nuestra capacidad de imaginar un futuro mejor. (Dreams are the manifestation of our creativity and our ability to imagine a better future.)

16. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

17. Promise babayaran kita in the future. sabi ko sa kanya.

18. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

19. Supporting policies that promote environmental protection can help create a more sustainable future.

20. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

21. The uncertainty of the future can cause anxiety and stress.

22. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

23. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

Random Sentences

1. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

2. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

3. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

4. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

5. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

6. Hinayaan kong maglabas ng malalim na himutok ang aking kaluluwa upang mapawi ang aking pangamba.

7. Kapag wala akong iniisip na problema, ako'y nakakaranas ng isang matiwasay na pagkakasundo sa aking sarili.

8. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

9. She has a poor credit history due to late payments and defaults on loans.

10. Nagsimula ang kanilang kwento sa isang takipsilim.

11. The traffic on social media posts spiked after the news went viral.

12. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

13. Humingi ng paumanhin ang inang makakalimutin subalit nagsiklab sa galit ang anak na sutil.

14. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

15. Television has a long history, with the first television broadcasts dating back to the 1920s

16. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

17. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

18. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

19. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

20. The professional athlete signed a hefty contract with the team.

21. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

22. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

23. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

24. Sino pa, isisingit ni Ogor, di si Dikyam!

25. Ang bilis natapos ng palabas sa sinehan.

26. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

27. Les étudiants ont accès à des ressources pédagogiques en ligne pour améliorer leur apprentissage.

28. El ajedrez es un pasatiempo que disfruto desde niño.

29. The bookshelf was filled with hefty tomes on a wide range of subjects.

30. Las escuelas tienen un impacto significativo en el desarrollo de los estudiantes y su futuro éxito en la vida.

31. His administration pursued a more confrontational stance towards countries like China and Iran.

32. Natakot ang batang higante.

33. Está claro que la situación ha cambiado drásticamente.

34. Nakatulog ako sa harap ng telebisyon at nagitla ako nang biglang nagtaas ang boses ng mga artista sa palabas.

35. The stock market can be used as a tool for generating wealth and creating long-term financial security.

36. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

37. Les astronomes étudient les étoiles et les galaxies.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. Nangangako akong pakakasalan kita.

40. Maputi si Kano, kaya ganito ang tawag dito sa kanilang pook.

41. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

42. Ang paggawa ng sining tulad ng pagpipinta o pagguhit ay isang nakagagamot na paraan upang maipahayag ang aking damdamin.

43. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

44. Si Teacher Jena ay napakaganda.

45. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

46. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

47. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

48. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

49. Twinkle, twinkle, little star,

50. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

Recent Searches

futuredamingdulapatingkaysarapbigoteraymondanyobihiratinulak-tulakmaligoguloikinuwentohindepinakalutangnangyaringmatatalomarumipinaghihiwanag-umpisacoughingnagkaganitoiatfalsoabotbastadondigitalnagpapaypaybaclaranmapayapaartistnamataypayapangnaturmamayanghumalopanitikan,nakikitamamayatubig-ulanpinangyarihankapwahalamanangkumbinsihindibamakitainilistapresence,suhestiyonmanoodpagkainprutaskasaysayanhenrybrindarsellingumanopinabulaanangiyaknatapakansayanagsisihantheninanglimanguddannelsepumansinnazarenoinutusanpanatagniyondawsiglomuntinlupananlalamigpromisenakaakyatnaglipanangrisebilhannapakasinungalingpinagbubuksanalismagandanghawlapakiramdamibonkapilinghamaksumunodhapunanmustdiferentesnakabaliknuhnapadungawkendtkalanritakakapanoodnatayoinformationmasayang-masayangbeautifulexpresanmayamannaroonhumigalawasimulaeditnapapadaannicelineexpertiseeuphoricnaghandaanthonyhiligmagpagalinglangitkatagangmaunawaanmagbaliklabahinlumakilumungkothinagpismorningnapapahintosampaguitaumayoshapdisambitkumembut-kembotpaananyatahelpalas-tressabibarongipinasyangnagbagohanap-buhayhuwagsinonatutoadditionrailwayssangdamiseryosonanonoodhitasumasambakakaibangkumpletomagtatanimsaranggolareturnedkomunikasyontanggalincalidadpapelnoodkailanmanlasingerotradisyonarghcuriousmabangoagosnapabayaannagtatanimnagpuntanaliligobagolabingninumanbulalasumiiyakiikutandreamst-isaapomaasahantagumpaypakpakmahusaylaranganhunimagtipidtelebisyonasahanbungangtataysagabalpropesorunconstitutional