Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "duwende"

1. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

2. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

Random Sentences

1. It is brewed from roasted coffee beans, which come from the Coffea plant.

2. Athena.. gising na. Uuwi na tayo maya maya.

3. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

4. Nag-ayos ng gamit ang mga mag-aaral nang limahan.

5. If you quit your job in anger, you might burn bridges with your employer and coworkers.

6. They have been dancing for hours.

7. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

8. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

9. Paano mo nalaman? tanong ko sa kanya.

10. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

11. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

12. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

13. Nasa kanan ng restawran ang sinehan.

14. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

15. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

16. A couple of weeks ago, I went on a trip to Europe.

17. Ang yaman pala ni Chavit!

18. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

19. Kailangan ko munang magpahinga para mawala ang inis ko.

20. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

21. Nakakain ka ba ng mga pagkaing Pilipino?

22. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

25. S-sorry. mahinang sabi ni Mica.

26. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

27. Det anbefales at udføre mindst 150 minutters moderat intensitet eller 75 minutters høj intensitet træning om ugen.

28. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

29. I know you're going through a tough time, but just hang in there - you're not alone.

30. The level of sweetness can vary in different types of sugar and sweeteners.

31. Ipaghanda mo si Lina ng Maghanda ka ng damit

32. Leonardo da Vinci también pintó La Última Cena.

33. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

34. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

35. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

36. Athena.. malapit na tayo.. konting tiis na lang..

37. I don't think we've met before. May I know your name?

38. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

39. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

40. Many dogs enjoy going on walks and exploring new environments.

41. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

42. Sa buwan ng Mayo ang kaarawan ko.

43. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

44. Tibig ng ligaya ang puso ng mag-asawa sa pag kakaroon ng maipagmamalaking anak.

45. Wala dito ang kapatid kong lalaki.

46. Nagbabaga ang talakayan sa klase habang nagtatalo ang mga mag-aaral tungkol sa isyu.

47. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

48. Ang parke sa amin ay mayabong na may malalaking puno at makukulay na mga dahon.

49. Ang Ibong Adarna ay nagpapakita ng kapangyarihan ng kabutihan at pag-ibig sa pagharap sa masasamang tao.

50. They are running a marathon.

Recent Searches

duwendenuevoincrediblepagsidlanbinabaratbihiranuevosestasyoncompostelamagka-apotennisharmfulgagamitemocionesmagpakaramihabitsbintananasilawginawangnagdabogcover,mahabolyukopulgadasinimulanbasketballnovelleshealthpublicitykailanmariloumisteryosemillasmerchandiseubokakayanangmalayangmalakiannikatupelobumigayagilautilizarlipadpssslamesaartssamfundumingitvaccinesburgertakesfuelpopcornmaluwangbigongginagawatolmagbigayanimagesbarabasyeheytuvonatulogmatigasproducts:pebreromakulittenerhardtomarcommunicationnaminschoolcondocuentanmulicornerskasangkapankaringtumawaearnvideoagamulighedkulisappaulmaisbakunapagkaraanfremtidigesinunud-ssunodsinipangpinahalatamallswalangblusanagsidalospiritualkasomisssumayawngipinngayonnegrosnausalpagkasabinaubosiniresetavigtignatuyonatingnapawinamulanakuhanaabotmusmosmuligtmodernkuyaminutoarteminsanmimosatinataluntonmemorymelvinkumalatmedidamataaspaghamakmasamamanoodmanggapabalikmamayamalayoresponsiblemalagomalabomakitamakakapagmakainmagawamadamiquezonmabiromaasimmaarawmaalogmaabotandroidlunetalumayodahilanlumangipasoklondonlockedsincelittlelingidnotlimanglibingpumilinagtawananlegenditspupursigilaylaylasinglangyalangitrightslangawlalonglakingkwartokumuhakumainkukuhabagyongkayang-kayangpagkakataongknighthigitkitangkabibitelangsweetfeltbinigaynakakasamakilalanakakadalawmagkakailamagbabakasyonnabalitaan