Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "require"

1. Different types of work require different skills, education, and training.

2. Dogs are social animals and require attention and interaction from their owners.

3. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

4. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

5. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

6. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

7. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

8. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

9. Microscopes require careful handling and maintenance to ensure accurate results.

10. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

11. They are not considered living organisms because they require a host cell to reproduce.

12. This can generate passive income for you, but it does require some capital to get started

Random Sentences

1. Hindi dapat gamitin ang credit card nang walang sapat na pag-iingat dahil ito ay nagdudulot ng dagdag na gastos at utang.

2. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

3. Einstein was a refugee from Nazi Germany and became a U.S. citizen in 1940.

4. ¡Hola! ¿Cómo estás?

5. Ang kanyang ama ay isang magaling na albularyo.

6. I finally quit smoking after 30 years - better late than never.

7. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

8. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

9. Are you crazy?! Bakit mo ginawa yun?!

10. Det er vigtigt at give børn en kærlig og støttende opvækst.

11. Electric cars can help reduce dependence on foreign oil and promote energy independence.

12. A couple of candles lit up the room and created a cozy atmosphere.

13. Limitations can be a result of fear or lack of confidence.

14. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

15. By refusing to compromise, she ended up burning bridges with her business partner.

16. Handa na bang gumala.

17. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

18. Ganun ba? Sige samahan na lang muna kitang maghintay dito.

19. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

20. Nagitla ako nang biglang bumagsak ang mga plato sa kusina.

21. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

22. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

23. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

24. The sun is setting in the sky.

25. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

26. Oy saan ka pupunta?! Bayad ka na!

27. Ang koponan nila ay mas handa at mas determinado, samakatuwid, sila ang nagwagi sa paligsahan.

28. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

29. Nandito ako sa entrance ng hotel.

30. Einstein's legacy continues to inspire scientists and thinkers around the world.

31. El coche deportivo que acaba de pasar está llamando la atención de muchos conductores.

32. He has been writing a novel for six months.

33. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

34. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

35. Bumalik siya sa Pilipinas kasama ang suporta ng mga Amerikano noong 1898.

36. Limitations are the boundaries or constraints that restrict what one can or cannot do.

37. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

38. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

39. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

40. Kucing juga dianggap sebagai hewan yang bisa membantu mengurangi stres dan kecemasan.

41. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

42. Proper training and socialization are essential for a well-behaved dog.

43. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

44. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

45. L'entourage et le soutien des proches peuvent également être une source de motivation.

46. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

47. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

48. Shaquille O'Neal was a dominant center known for his size and strength.

49. Aanhin ko 'to?! naiiritang tanong ko.

50. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

Similar Words

requires

Recent Searches

requireoftenexplainspreadcompletequicklyclassmatepackagingeffectsnegativelargeuseeachthingsimplengonlyincreasedmuchslavelisensyarelievedmaynilaatbio-gas-developingpinakamatunogmagpa-checkupanibersaryoalamregularpansamantalamerlindagripomamanhikanpusongbabapakukuluanpagkalapitpaglalababrasogabiatensyonkulogpangingimidivisionindustryguestsmateryalesdumarayomagbungavehiclesvismakikiraanbarnesnapanoodskyldes,mantikakundibangkongapatearlypumansinkumaenmatalimenfermedades,tumaholhubad-baronagliwanagnagtataetamarawcultivarmalapalasyokargaandrewmaluwangmagmaongmatabangbroadcastingnahigaitutolpresyotrenmarchantvaccinesadoptedancestraless-sorryipinambilidiliginprovepisounoailmentslifeiginitgitkumukuhamagpa-pictureoktubrenakikini-kinitajapanluluwaskatawangsabadongmakikipagbabagnagpalalimpagpapasanmanggagalingnapatawagpagkamanghatinaasannapapalibutanpagkakamalikaaya-ayangtaga-nayonpinakamatabangmagkaibigannakatayonagmungkahirevolucionadokinatatakutanlumalangoymagkakaanakmedya-agwatarangkahan,barung-barongnag-aalanganmagbabakasyonnaninirahanmakapangyarihannagtutulunganagwadorkasalukuyanunibersidadnagtatakboikukumparaexhaustionbagsakpalancapinakidalapangangatawankabutihantemparaturapaanongkalayuannagmadalingnapasigawpangyayarikalalaroihahatidbiologisiniyasatbefolkningen,selebrasyonnagpagupitballmagsabipakistanindustriyaumagangpalasyotieneniligtasperpektingnakainomkisapmatanagbagotulisangelailumusobempresasganapinmahabolplantasautomatiskpaglapastanganna-fundnaghihirapprodujonangyarinapasubsobnapuyatnakatitigkidkirantumiranaiilanglabinsiyamlumakastinakasanmakakibotumakaspaki-ulityakapinnalalabingmagbantaypawiinmarketinghablabakadalasnaaksidentemangyariumiibig