Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "dumilat"

1. Dumilat siya saka tumingin saken.

Random Sentences

1. Leonardo da Vinci fue un gran maestro de la perspectiva en el arte.

2. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

3. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

4. The website's analytics show that the majority of its users are located in North America.

5. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

6. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

7. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

8. Omelettes are a popular choice for those following a low-carb or high-protein diet.

9. Investing refers to the process of allocating resources with the expectation of generating a profit.

10. La seguridad en línea es importante para proteger la información personal y financiera.

11. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

12. Wala namang ibang tao pedeng makausap eh.

13. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

14. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

15. Einstein was a vocal critic of Nazi Germany and fled to the United States in 1933.

16. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

17. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

18. Alam kong heartbeat yun, tingin mo sakin tangeks?

19. Sa Tokyo Olympics 2020, napanalunan ni Hidilyn Diaz ang gintong medalya sa weightlifting.

20. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

21. He does not play video games all day.

22. Pagpasok niya sa bahay, nabigla siya sa liwanag na biglang sumulpot.

23. Emphasis is often used in advertising and marketing to draw attention to products or services.

24. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

25. Itinago ni Luz ang libro sa aparador.

26. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

27. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

28. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

29. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

30. Isang linggo nang makati ho ang balat ko.

31. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

32. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

33. Tinatawag niya ang anak ngunit walang sumasagot.

34. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

35. Ordnung ist das halbe Leben.

36. Sa gitna ng kanyang pagbabasa, nabigla siya sa malakas na kulog at kidlat.

37. Mathematics is the study of numbers, quantities, and shapes.

38. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

39. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

40. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

41. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

42. Limitations can be addressed through education, advocacy, and policy changes.

43. Heto po ang isang daang piso.

44. I sent my friend a bouquet of flowers and a card that said "happy birthday."

45. Mi amigo del colegio se convirtió en un abogado exitoso.

46. Ano ang binibili ni Consuelo?

47. Hindi ko ho kayo sinasadya.

48. Put all your eggs in one basket

49. Dadalaw ako kay Lola Sela bukas.

50. Mahilig sya manood ng mga tutorials sa youtube.

Recent Searches

nakaindumilatsandwichsakenginoongnakabaonpilipinassaringsamakatuwidwordcurrentinfluencesfe-facebookartekunwanatulakbookspakisabipublicitymaliitgigisingmatulisinatakebecametamaplagaskasalahasbigongmagigitingkuwebasamakatwidmalamangnapatinginlookedmalayangtagalogfauxpaksalivesmagtipidtoothbrushcollectionsarghconsistmadamiharap1787balancestransmitidasipaliwanagugaliabenemarchbuwalperangsumamahumanocommissionasinkabibimasdancommercialmakitageneratebringingenchantedtwinkleilaniosbubongincreasinglyplayedcharmingspreadguidecontinuegitarasafe2001relevantconstitutionscalestatedingsinumansiopaosoreglobalayanmagpaliwanagnakatirangmabihisanrebolusyonnakapasamaghaponjejuaniiligtasginawarannagbibigayanmisyunerongbahagyangpagpapakilalapromiserimasnobodytmicatawatibigsinimulanpumatolmahahababigyanumanoniyogthirdbitiwansinapakpagematagpuanauditcleancoatbinatakuwaknapakalusogmagsubowagmaestramakapalhundredpalasyopunopunung-punosocialeskagandahanitemssmokingusenoowebsiteitinatapatfieldworkingfarnagkalatnagisingginawasumingitcnicoenergitoypagkatpeacegustotinitindaaddictionhoyo-orderestilosbundokdognaka-smirkkapangyarihanpapagalitankinauupuangnagngangalangmakikipag-duetosalamangkeromakikiraanpagkakapagsalitarepresentativehouseholdaraw-arawbayabassusunodrenepinaghatidanmakikikainnapipilitannagmadalingpinabayaantatlumpungnaghuhumindignakikiahubad-baronakalilipasnakakagalakatawangmagsusunuranboytumawahulusabihinmahinayumuyukopagkasabifilipinamagbibilad