Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "scientific"

1. Einstein's brain was preserved for scientific study after his death in 1955.

2. Einstein's legacy continues to inspire and influence scientific research today.

3. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

4. Microscopes are commonly used in scientific research, medicine, and education.

5. Microscopes have played a critical role in the development of modern medicine and scientific research.

6. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

7. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

8. Scientific data has helped to shape policies related to public health and safety.

9. Scientific discoveries have revolutionized our understanding of genetics and DNA.

10. Scientific evidence has revealed the harmful effects of smoking on health.

11. Scientific evidence suggests that global temperatures are rising due to human activity.

12. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

13. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

14. Scientific research has led to the development of life-saving medical treatments and technologies.

15. Scientific research has shown that meditation can have a positive impact on mental health.

16. Scientific research has shown that regular exercise can improve heart health.

17. The scientific community is constantly seeking to expand our understanding of the universe.

18. The scientific community is working to develop sustainable energy sources to combat climate change.

19. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

20. The scientific method involves forming hypotheses and testing them through experiments.

21. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

22. The scientific method is used to test and refine theories through experimentation.

23. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

24. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Punta tayo sa park.

2. Bigyan mo ng pera ang kapatid mo.

3. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

4. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

5. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

6. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

7. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

8. From there it spread to different other countries of the world

9. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

10. Balak kong magluto ng kare-kare.

11. Bumisita ako sa lola ko noong Mayo.

12. Gusto ko sanang ligawan si Clara.

13. Break a leg

14. Malinis na bansa ang bansang Hapon.

15. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

16. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

17. Itinuturo siya ng mga iyon.

18. Les élèves doivent travailler dur pour obtenir de bonnes notes.

19. Ipinakita nya ang determinasyon sa larangan ng boxing.

20. Nang balingan ng tingin ang matanda ay wala na ito sa kanyang kinatatayuan.

21. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

22. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

23. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. La armonía entre los instrumentos en la música de Beethoven es sublime.

26. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

27. Ang maniwala sa sabi-sabi, walang bait sa sarili.

28. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

29. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

30. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

31. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

32. Walang password ang wifi ng kapit-bahay.

33. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

34. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

35. Algunas plantas son comestibles y se utilizan en la alimentación, como las frutas y verduras.

36. Ang mga kundiman ay patunay na ang pag-ibig ay may lakas na magdulot ng ligaya at kalungkutan.

37. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

38. Después de lavar la ropa, la puse a secar al sol.

39. Mga guro sina G. Santos at Gng. Cruz.

40. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

41. Di natagalan, isinawak niya ang kamay sa nalalabing tubig sa balde.

42. Sa bus na may karatulang "Laguna".

43. May mga taong nakakaramdam ng kalungkutan at nangangailangan ng pagtitiyaga at pang-unawa kapag sila ay mangiyak-ngiyak.

44. The stockbroker warned his client about investing in risky assets.

45. Más vale prevenir que lamentar.

46. Maraming mga anak-pawis ang hindi makatugon sa kanilang mga pangangailangan dahil sa kakulangan ng oportunidad.

47. Wag na, magta-taxi na lang ako.

48. En invierno, los días son más cortos y las noches son más largas.

49. Bigyan mo muna ako ng dahilan kung baket. sabi ko.

50. Revise and edit: After you have a complete draft, it's important to go back and revise your work

Recent Searches

scientificmerrygivesisikatpulubiahitcontestbinigaytoothbrushseenaggingformawestcivilizationbreakdulaclassroomimpactkartonmanualeksenafaultwellfigurescoachingbustransitsumangitinaliagilitykarangalanmaestrabiyernesnangingilidpauwipromisekapitbahaykaratulanguusapaniskedyullagingtaksiairplanesmakausapnatakotmalasutlakontingbihasalupainkatagangtambayancarmengiveruntimelymaibalikhimselfreducedgayunpamanpagkalungkotbastacallerbilibdisyembresusuliteducationplasamalihisipinasyangoposetyembrebinilhancinenapatingalaiatfmansanasgranadahablabaeducativastinderagrinssupremetapatbatiawasorewidespreadleukemiasugatanpinapasayangunitsumasambafacebookdevelopedlatechadspecializednatingalagreenoncesumalishowsorry1977bawatemailvedsciencecharmingnapakagagandanagnakawmagbabagsikfollowing,erlindatuluyaneconomyumiiyakkarunungankasangkapannakalagaynaka-smirkobserverermagasawangkinapanayamkikitatumubofloorbiocombustiblespinakamaartengkumukuhapinagkaloobanpinakamahalagangsponsorships,nagre-reviewpamburahealthiernalalaglagreserbasyonkahirapanpagkakayakapmakapaibabawnakikilalanggayunmannakuhamarketplacesnakapapasongginugunitakonsentrasyonpaglakipagkagustomangkukulamhumiwalaynagreklamonakatalungkonagpagupitrevolutioneretsakristantig-bebentedadalawininaabutanpaglisanmagpakasalmahahanaynakaririmarimsparepinanaghihikabhalu-halotaga-hiroshimamakabilikwartolumakimakakibopagdudugomatagpuannakakatandacancerpakikipagbabagpaglapastanganmawawaladaramdaminnalugmoknagdiretsonapanoodintramurosisinagotmaglalakadberegningeropisinaplantasprimerospagkagisingdropshipping,kolehiyoitinatapatkamandagnapapansindisfrutarnakasakitnapasubsoblumayo