Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "scientific"

1. Einstein's brain was preserved for scientific study after his death in 1955.

2. Einstein's legacy continues to inspire and influence scientific research today.

3. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

4. Microscopes are commonly used in scientific research, medicine, and education.

5. Microscopes have played a critical role in the development of modern medicine and scientific research.

6. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

7. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

8. Scientific data has helped to shape policies related to public health and safety.

9. Scientific discoveries have revolutionized our understanding of genetics and DNA.

10. Scientific evidence has revealed the harmful effects of smoking on health.

11. Scientific evidence suggests that global temperatures are rising due to human activity.

12. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

13. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

14. Scientific research has led to the development of life-saving medical treatments and technologies.

15. Scientific research has shown that meditation can have a positive impact on mental health.

16. Scientific research has shown that regular exercise can improve heart health.

17. The scientific community is constantly seeking to expand our understanding of the universe.

18. The scientific community is working to develop sustainable energy sources to combat climate change.

19. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

20. The scientific method involves forming hypotheses and testing them through experiments.

21. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

22. The scientific method is used to test and refine theories through experimentation.

23. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

24. The scientific study of the brain has led to breakthroughs in the treatment of neurological disorders.

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nakakain ka ba ng mga pagkaing Pilipino?

2. 'Di ko ipipilit sa 'yo.

3. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

4. Pwede ba Maico, wala kang pakealam! singhal ko sa kanya.

5. Puwede bang makausap si Clara?

6. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

7. She is studying for her exam.

8. Naglalaba si Maria ng mga damit tuwing Linggo para sa buong pamilya.

9. Ang sakit niya ang nakapanghihina sa kanya.

10. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

11. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

12. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

13. Hinawakan niya iyon sa magkabilang tirante.

14. Les sciences sociales étudient le comportement humain et la société.

15. Naku, may boyfriend ako eh. sabi ko.

16. Hindi ko akalaing capable ka palang tumawa.

17. Quería agradecerte por tu apoyo incondicional.

18. The number of stars in the universe is truly immeasurable.

19. Tinawag nya kaming hampaslupa.

20. Bakit? sabay harap niya sa akin

21. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

22. Facebook Marketplace is a platform where users can buy and sell items locally.

23. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

24. Limitations can be a result of geographic location or access to resources and opportunities.

25. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

26. Les personnes qui ont une passion pour ce qu'elles font sont souvent plus motivées à y consacrer leur temps et leur énergie.

27. Hinanap niya si Pinang.

28. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

29. May mga punong-kahoy na pinaniniwalaang matatanda nang bago pa dumating ang mga kolonizador.

30. Omelettes are a popular choice for those following a low-carb or high-protein diet.

31. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

32. Nay, ikaw na lang magsaing.

33. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

34. The objective of football is to score goals by kicking the ball into the opposing team's net.

35. The roads are flooded because it's been raining cats and dogs for hours now.

36. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

37. Masyado siyang tulala sa kanyang pangarap at hindi na niya napapansin ang totoong mundo.

38. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

39. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

40. Lingid sa lahat, si Tarcila ay isang diwata.

41. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

42.

43. Sumakay sa jeep ang mga pasahero nang limahan.

44. The number you have dialled is either unattended or...

45. Alay ko sa iyo ang bawat sandali ng buhay ko.

46. Dumating ang bus mula sa probinsya sa hatinggabi.

47. Nagpunta ako sa Hawaii.

48. My best friend and I share the same birthday.

49. Mayroong hinahabol na magnanakaw sa kalsada na inaabangan ng mga pulis.

50. Has he learned how to play the guitar?

Recent Searches

congressscientificbarnesdollyminutowestkablanconsistputingsyncsourceamazonworkshopinternalnamunganeverregularmentecreationcontinueseyeinterpretingtwinklesumapitdrewexpertdragonsatisfactionlackkamaysecarsehimignaggingspeechdanceorderlibreartificialarealastingjanmarahiltinikmanbaulprogramming,magkasamapakinabanganagostokinainclientesbalitakwelyotrabajarmagtagotutusinmagpaniwaladoble-karaculturalnitongkagandahagtumagalmagkaharaphouseholdskalaunankinasisindakannaliwanagannakatapatrosasilalagaymagdamagansakyanmantikakinakainparinundeniablenagwikangbinawianmaibabalikbibilhinhinukayyankaraniwangboholnakatinginangkanmagdaconditiontransitsoccerkakahuyanpilinginilalabasmakatarungangtagtuyotenergy-coalpamahalaanpinahalatapinakabatangpagkakatayoasolumiwagnagmamadalitatawagnakalilipaspinapakiramdamankalakihanmarketplacesmadalaskinatatakutanmakauuwipinag-usapannapakatagalmanilbihannagliliwanagnakapamintanamorningpresence,pagkagustonagpagupitmakikikaininsektonghumiwalayforskel,magsusuotromanticismofitnessexhaustionpakikipagbabagmagtataassiksikantabingmagsugalmakauwiabundanteumakbaynakahugsoftwarepintuantumiranahigitanpagkaangattagaytayvirksomhedertumakasartistlumuwaspinapataposyou,titirapinangaralanvidtstraktuniversityenglishmakaiponumiisodbutikiconditioningpesoniyotsinakastilangmagisipbinuksansisikatlubosdalawangsakayberetisongsipinambilipauwiaguaminamasdankainisperwisyoindependentlyheftypnilittanawcampaignsmatalinonutrientes,senate1787shopeeeducativasbinilhankongsumagotlandbumigayrosellepongnaglabananmagbigayanhoykaysatomorrowhinampasproyektoimportantes