Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "bank"

1. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

2. He used credit from the bank to start his own business.

3. Hello. Ito po ba ang Philippine Bank?

4. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

5. Money can take many forms, including cash, bank deposits, and digital currencies.

6. The bank approved my credit application for a car loan.

7. The credit card statement showed unauthorized charges, so I reported it to the bank.

Random Sentences

1. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

2. I complimented the pretty lady on her dress and she smiled at me.

3. Ano ang ginawa mo noong Sabado?

4. Binilhan ni Fidel ng bulaklak si Imelda.

5. Hindi ko matiis ang mga taong laging mangiyak-ngiyak.

6. The reviews aren't always reliable, so take them with a grain of salt.

7. The platform has implemented features to combat cyberbullying and promote a positive online environment.

8. Ang mga tulay sa aming bayan ay tinutukoy bilang mga mayabong na likuran na may bulaklak at mga halaman.

9. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

10. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

11. Nagliliyab ang kandila sa altar habang nagsasagawa ng dasal.

12. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

13. Gusto kong namnamin ang katahimikan ng bundok.

14. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

15. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

16. Haha! I'd want to see you fall inlove tonight.

17. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

18. Di mana bumi dipijak, di situ langit dijunjung.

19. Sa facebook kami nagkakilala.

20. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

21. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

22. There are a lot of benefits to exercising regularly.

23. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

24. Frustration can also be caused by interpersonal conflicts or misunderstandings.

25. Boboto ako sa darating na halalan.

26. Hinahangaan siya ng marami dahil sa kanyang pagiging mapagkumbaba kahit galing siya sa mababa na estado ng buhay.

27. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

28. She was feeling tired, and therefore decided to go to bed early.

29. We have already paid the rent.

30. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

31. Hitik na hitik sa bunga ang nasabing puno.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

34. The garden boasts a variety of flowers, including roses and lilies.

35. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

36. Ang pagtanggi sa mga ebidensya ay nagpapakita ng pagiging bulag sa katotohanan.

37. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

38. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

39. Det anbefales at udføre mindst 150 minutters moderat intensitet eller 75 minutters høj intensitet træning om ugen.

40. Ang kuripot mo naman, minsan lang ako magpalibre eh.

41. Mathematics provides a systematic and logical approach to problem-solving.

42. Television is a medium that has become a staple in most households around the world

43. Ano ang palitan ng dolyar sa peso?

44. Ang albularyo ang tumulong sa pamilya para maalis ang sumpa sa kanilang lupa.

45. They do not ignore their responsibilities.

46. Anong buwan ang Chinese New Year?

47. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

48. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

49. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

50. Napangiti na lang ako habang naka tingin ako sa kanya.

Recent Searches

umibigbankreservescarbonkasakitayawsinakoppangkatmananaigpakilutoskypereguleringindustrychoosetignanelviskainpangingimidiagnosesmeaningbilinulamrabebecomewalngmatindinglimosstardinalawsinipangpresleysasabihintandadidingguestspyestagalitinfluencelibaghoweverexpectationsvisitemscontentmultoandycosechaspinatutunayannasabikinikitalumipaspagpapakalatothersdoktoradvancedkawalaniba-ibangsapagkatnyakaminghopepreviouslykapallindolmangnitongsalatlaganapstreamingpinipilitnapakahangasalu-salopinakamahalagangtechnologiespare-parehoikinakagalitnagmamaktolkinatatakutankommunikerertiktok,i-rechargenagpagupitminamahalnavigationmagkakailaalas-diyespagkakakawiteconomypinakamahabaintensidadtumakasnakataaspagdudugopagsusulitmadungismakalapitalapaapcompanysugatangmarketing:kadalasibinaonpinisilfollowedincitamenternaabotmakapasaeleksyonopportunitybihasasumasakayestatebobototinapaykumustabisikletabalakpagsisisikuwartokingdomsundaebritishlagunacoloreuphoric1929hmmmmsumagotbingotoothbrushmaskminuto1940lutolupangritwalleytepootmallconnectingdaantenfacebookdatiipagbilinangyarimatabalackbelievedbruceproblemahalagaeyeyangtabimariangfuncionarmarahilmastermarahasprovidednegativedancehimigmanuksomantikamanakboputahemanagersyncexplainberkeleypakibigaygapmamulotmamitasmamalasmalisanmalimitmalikotnagsidalomalihismalawakmalamigmakulitmakisigmahirapmahigitmahalinmahabolmagtakamagtagomagnifymatangosmaglarobiocombustiblespostmaglabamagkanomagisip