Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "bank"

1. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

2. He used credit from the bank to start his own business.

3. Hello. Ito po ba ang Philippine Bank?

4. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

5. Money can take many forms, including cash, bank deposits, and digital currencies.

6. The bank approved my credit application for a car loan.

7. The credit card statement showed unauthorized charges, so I reported it to the bank.

Random Sentences

1. Emphasis is often used to highlight important information or ideas.

2. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

3. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

4. Pero bigla na lang siyang hindi nagpakita.

5. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

6. Ang abuso sa hayop ay isang krimen na dapat mapanagot ang mga nagkasala.

7. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

8. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

9. Come on, spill the beans! What did you find out?

10. Ang pagbabayad ng utang sa tamang panahon ay nagpapakita ng katapatan sa pagbabayad ng mga utang at magiging magandang rekord sa credit score.

11. Cooking at home with fresh ingredients is an easy way to eat more healthily.

12. Ipanghampas mo ng langaw ang papel.

13. Bumili si Ryan ng pantalon sa palengke.

14. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

15. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

16. Ano namang inasikaso mo sa probinsya?

17. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

18. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

19. Hinawakan ko yung tiyan ko, Konting tiis na lang..

20. The laptop's hefty price tag reflected its powerful specifications and high-end features.

21. Halos gawin na siyang prinsesa ng mga ito.

22. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

23. Wala ka naman sa kabilang kwarto eh.

24. They offer rewards and cashback programs for using their credit card.

25. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

26. Ah miss, tanong lang... Iyo bang lahat yan?

27. Keep in mind that making money online takes time, effort, and patience

28. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

29. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

30. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

31. Les travailleurs peuvent travailler de manière saisonnière, comme les agriculteurs.

32. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

33. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

34. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

35. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

36. Ang bilis naman ng oras!

37. Bawal magpaputok ng paputok sa hindi pagkakaroon ng pahintulot ng lokal na pamahalaan.

38. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

39. Hindi man nanalo sa halalan, bagkus ay binati pa rin nang natalong kandidato ang bagong mayor.

40. Napakaganda ng mga pasyalan sa bansang Singapore.

41. Ngunit marumi sila sa kanilang kapaligiran.

42. I am absolutely committed to making a positive change in my life.

43. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

44. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

45. Det er også vigtigt at varme op før træning og afkøle efter træning for at reducere risikoen for skader.

46. Sino ang pupunta sa bahay ni Marilou?

47. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

48. Sabi ko sa inyo, halos kumpleto kami kasi wala si Sync.

49. Trenta pesos ang pamasahe mula dito

50. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

Recent Searches

banknakakarinigturoprofessionalmesapagkatmumuranakapagproposekarangalanlagunaginawanaritolibertymungkahinapakasipagelectbeginningiyonumagakanluranunidosabutangisingmahinaadditionallysakenbiyernesbarung-barongalmusalnagwo-workmaasimpinapakiramdamanpirasodisposalmalakiloobpalibhasabathalaparaanmakilalapalamutimagbabakasyonmagtipidnangangalitnakakunot-noongkumananmagpa-checkupnabahalarevolucionadotahimikganidfriendmalamandatapwatkaytandaprutasenergy-coalformtusongteleponobansapambansangnagpapaitimtangkakadaratingambagprinsipematamiskontramahigpitmainittumaloninuulamnakakasamaanokumalatresultamadurodinadaanannilulonuwakbukodmatalinopaldanecesitanabigaydapatnakalipascantidadtugonalaalahimigdahonbilangguanproblemaprogramapabiliiyobumaligtadnohnagsisihansilyanagpakilalasunud-sunodinspirasyonmakatinakasilonglarawantumubomalawaksandalikuwartobumabagracebuwiskakilalakaloobanryannagdaosanungkulungantigiltuminginmarahanpaslitinitmakakayanalalabimenuhumarappresleynitokalalaromangingisdagenerababiyaskabinataantayosapotsaglitwaringmahiwagamaaksidenteninyongtumayonag-ugatelementaryipinatingnanpaggawamalltrabahoaminlalawiganrawibagayundinkongagam-agamkahitreynalasauniversitynapalingongreatnakitulogself-publishing,bodegapaglalabaniyanislandvegasamoquarantinepawiintinutopbiglamatariksingsinglabanisusuotcertainnegroskarnediscouragedtulotangansariwasakamakakalimutinannabatalantumabaaddictionpromisemisyunerongbibisitamakisuyopagkain