Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Sumakay ka sa harap ng Faculty Center.

2. Magaling maglaro ng chess si Joseph.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

5. Ang daming bawal sa mundo.

6. Isang linggo nang makati ho ang balat ko.

7. If you did not twinkle so.

8. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

9. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

10. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

11. I can't access the website because it's blocked by my firewall.

12. They are not attending the meeting this afternoon.

13. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

14. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

15. Les employeurs offrent des formations pour améliorer les compétences des travailleurs.

16. Naiinitan talaga ako, malamig ba labi mo?

17. Ano hong klaseng sawsawan ang gusto ninyo?

18. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

19. Superman possesses incredible strength and the ability to fly.

20. They analyzed web traffic patterns to improve the site's user experience.

21.

22. Estudyante sina Rita at Fe sa UP.

23. Einstein was offered the presidency of Israel in 1952, but declined the offer.

24. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

25. Sa mga lugar na mabundok, naglipana ang mga halaman na katangi-tangi sa kanilang ganda.

26. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

27. Ano pa ho ang pinagkakaabalahan ninyo?

28. Hindi inamin ni Jose na sya ang nakabasag ng pinggan.

29. Instagram has become a platform for influencers and content creators to share their work and build a following.

30. Nagpapantal ka pag nakainom remember?

31. Bukas na lang kita mamahalin.

32. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

33. Sa oras na makaipon ako, bibili ako ng tiket.

34. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

35. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

36. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

37. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

38. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

39. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

40. Gracias por tu amabilidad y generosidad.

41. Nahantad ang mukha ni Ogor.

42. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

43. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

44. Biasanya, orang tua bayi akan mengundang kerabat dan tetangga untuk bersama-sama merayakan kelahiran anak mereka.

45. They have been running a marathon for five hours.

46. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

47. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

48. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

49. Je suis en train de manger une pomme.

50.

Similar Words

morena

Recent Searches

moremagpa-paskoiniskapaligirannapakatalinonicopilipinoaminmagugustuhaniligtassobratelapilalibromalakipangangatawanticketkagipitannavigationmangepinabulaanattorneyprincehinintaymaipapautangtheirbayanlalakiimportanttechnologicalnagmakaawaagadkasingtigastanongpamanlendingtumaholsiramagdilimmabiroopopulangumokaylegendangkopbarkotuhodsolmathnag-aalalangsagasaanalampagsalakaypinapalopadrenanghihinayoutube,makapasaaguayoungkungadditionmadalingstartbiyasintramurosnatuwafitnessbalitanasasakupanpag-aanikasamanaglulutosaannabitawanpermitenmasayangwarimatatandamaliksiextremistpagka-diwataitinalikokakkahonghumarapmayomag-aaralnanalomeronpangulonag-emailstuffedditomatamankaminasabingpaglipasrefkingdomcertainwriting,umakbaynagkakakainassociationcareerbugbuginano-anoyamandumagundongespecializadasmanualtugonbaliwnakakalayomakikitainjurytsongtaganobelacompanymatulungindalagagawingbumabagayosnyamakatipupuntahanoccidentalsallyspaghettinamanunababaenakakulongcedulasanahadnaturalsimonsarilingpamilyangangworkinglumikhaplasmakuripotvehicleslahatlugawtokyomatatagnanoodpaki-bukassinuotkindergartentigasindiaroonganapinsaadbaldepayongrelosalatsapatmakuhakalakihantakboahasnanggagamotnagdiskodulakinissnaglalaronagalitapoylawanerospinakamahabaobviouskabosessaranggolachefonebayabasbarongtamakaarawanrecibirsaan-saandinsipagganangleadbanyopagtayobahatito