Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Ihahatid ako ng van sa airport.

2. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

3. Pupunta kami sa Cebu sa Sabado.

4. Nag shopping kahapon si Tita sa SM.

5. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

6. Ano-ano ang mga nagbanggaan?

7. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

8. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

9. Bihira na siyang ngumiti.

10. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

11. Hang in there and stay focused - we're almost done.

12. Ok lang ba to? Baka naman magalit si Abi.

13. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

14. Omelettes are a popular choice for those following a low-carb or high-protein diet.

15. Mabait ang mga kapitbahay niya.

16. No puedo comer comida picante, me irrita el estómago.

17. Maraming iba-ibang kulay na ilaw sa parke.

18. Pinatawad din naman ni Ana ang mga ito.

19. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

20. Napunit ang papel ng saranggola dahil sa malakas na hangin.

21. Te agradezco por estar siempre ahí para mí.

22. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

23. Sa mga basurahan, naglipana ang mga langaw na nagiging sagabal sa kalinisan.

24. S-sorry. mahinang sabi ni Mica.

25. I love to eat pizza.

26. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

27. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

28. Smoking can be addictive due to the nicotine content in tobacco products.

29. The company's acquisition of new assets will help it expand its global presence.

30. Nagluto ng pansit ang nanay niya.

31. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

32. Pwede mo ba akong tulungan?

33. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

34. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

35. At samantalang nakadapa, unti-unting nabuo sa walang malamang sulingan niyang mga mata ang mga paang alikabukin.

36. Haha! Bakit masama bang makidalo sa ball ng ibang school?

37. Umiiyak ang kanyang mga magulang ngunit alam nilang wala na silang magawa para sa bata.

38. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

39. Nagsmile si Athena tapos nag bow sa kanila.

40. Kung may tiyaga, may nilaga.

41. Gusto kong namnamin ang katahimikan ng bundok.

42. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

43. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

44. As your bright and tiny spark

45. Naaksidente si Juan sa Katipunan

46. El internet ha hecho posible el trabajo remoto y la educación a distancia.

47. La santé est un état de bien-être physique, mental et social complet.

48. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

49. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

50. The United States is a federal republic consisting of 50 states, a federal district, and five major self-governing territories.

Similar Words

morena

Recent Searches

morekakaininhacerpagtatanongjackkalayaanyeheykamatisradyogamitlamanmaligayasimplenginitngunitgoodnyahassubalitmagalangonebalikatniyonnakatanggaptinalikdanpamilyaalamactionkitaestablishexpertiseakohigaannararamdamankontravideohalamansalamatabotmatapangromerokansercardmaestrabipolargripohapag-kainanmalayoumiiyakwealthnatatawakalagayanbranchmarahildebatessilayhinihintaytawagnagkakakainsino-sinosingaporewatchingpuedeawitannecesitadettilainisipprusisyoninilagaytumambadallowingsitawpersonasyongsuzetteilanglinebumahaimportantesmabutiakinbethleftsidostudiedprotegidomagbabalakusinerotatayonagtanghaliankomunidaddrogasakupinmatatandanapakagandapalagigumagawatugonnamnamintatayltosinghaldrinksloob-loobailmentsumibigtanganpangetpakelamnitobakalongsarilingkaysangbuwislasananaisinmalalimpadreimpactderpampagandapaguutoskubyertossiponmasayang-masayangpakanta-kantagrahamnalagutanwariayawpagguhitkinainpriestipaghandanaminiyakpag-unladtiniradornatindoktorhinabiaccessatentoownstateskayalabissmokernotkinikilalanggreenhillspabalangtamaitoditomumuntingaraw-arawfanspanghihiyangkuripotbangstudynamumuomariasucht-ibangsultanjudicialdahilriskibinentamatikmanshiningnaniniwalanagkaroongumagamitusenapagkindergartenguiltynoonkaramihanpagsubokpinag-usapanpagsusulathimutokworryisiptakotmaskiactingnagpupuntamaskaraconditioningmungkahisimbahancharitable