Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

2. Inakalang madali lang ang gawain, pero ito’y masalimuot pala.

3. Tumahimik na muli sa bayan ng Tungaw.

4. The Flash can move at superhuman speed, making him the fastest man alive.

5. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

6. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

7. Sa kanya rin napapatingin ang matatanda.

8. Linggo ng umaga at ang palengke ay siksikan.

9. Kulay itim ang libro ng kaklase ko.

10. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

11. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

12. Laging sinusuklalyan ng kaniyang ina na si Aling Pising ang kaniyang buhok.

13. Mathematics has many practical applications, such as in finance, engineering, and computer science.

14. Sa muling pagkikita!

15. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

16. Payat at matangkad si Maria.

17. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

18. Magkano ang bili mo sa saging?

19. Nagpasya akong tumigil at magpahinga nang magdidilim na ang paligid dahil sa sobrang pagod.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

22. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

23. She has started a new job.

24. I used a traffic app to find the fastest route and avoid congestion.

25. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

26. Ang buhawi ay isang malakas at mapaminsalang bagyo na karaniwang nagdudulot ng malakas na hangin, pag-ulan, at pagbaha.

27. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

28. Nasawi ang drayber ng isang kotse.

29. Bumisita ako sa lola ko noong Mayo.

30. Pumunta kami kahapon sa department store.

31. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

32. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

33. Mayroon pa ho sana akong gustong itanong.

34. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

35. Eh? Katulad ko? Ano ba ang isang tulad ko?

36. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

37. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

38. Tinuruan ng albularyo ang kanyang anak upang maipasa ang tradisyon ng pagpapagaling gamit ang mga halamang gamot.

39. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

40. Baka matunaw ako. biglang sabi niya. Langya gising pala!

41. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

42. Likas na mabait si Perla pasensiya na lamang ang kaniyang binibigay sa kapatid na si Amparo na ubod na tamad.

43. Sumalakay nga ang mga tulisan.

44. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

45. Tengo escalofríos. (I have chills.)

46. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

47. Anong oras mo gustong umalis ng bahay?

48. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

49. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

50. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

Similar Words

morena

Recent Searches

moretumambadflyvemaskinermawawalakasamaangtonpusodaliriconbunsomaagamananaogtuparinkaysayongnapapasabaywayumuwikartoncanadabatangmapditopapasaformsagapmarasiganhappenedoliviadrinkyoutaomakasakaynakaka-inramonopgaver,intyainbawatkagyatuuwigupitbatokpracticadohiningipagtayocantobungasiyangwinsproducts:muligtbulonglumiwagboyfriendgratificante,watchexpressionspopcornchildrennaglokobornmatamanmamamanhikangymtawananmeronimprovekaninabiglanginsektopinagpapaalalahanankapainkongmasmabaitpinakamaartengheartbeatloob-loobkumunotumibigailmentstumubogalitnaintindihangreatprogramming,ayongalakpamimilhinkuwadernoginaganoonpagkuwanyunnaglipanangoverviewkaano-anohalalankuwebambricosnamanneverlabisimportantesmaaksidentebaonlumipadproducemagugustuhangitaracorporationpaguutoslasingeroviolencepinagkaibanabitawanrestawanstarted:tumamasamastatusdibdibdeterminasyongownlargerpamilyangayongtagumpaypusongswimmingpshnapapansinsinusuklalyanfearkomunidadwordsnangampanyapag-uugaliantokspeechrenelalimdelaipinamilicreationbosesmaagangsiniyasatkumalatmagpakasalnagpapakinisbienshowmatatalogreaterpag-uwitulangmamisiponmasayang-masayangdunsumalasmilelumutangmananalopicsnowhangaringfriegayunpamanbokmakakuhasulathabangplaguedsmokehinabiaddictionwhyutospusangendvidererubberdistanciamandukotitanongfarmakangitipinalalayasbedsumiiyakmakapagsalitaredigeringmakikipag-duetopagluluksanagmartsapinaglagablabbagkusnaiyakmust