Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

2. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

3. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

4. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

5. The teacher does not tolerate cheating.

6. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

7. Athena. nagulat siya at bigla niyang pinatay yung monitor.

8. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

9. Itinago ko ang mga sulat para sa inyo.

10. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

11. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

12. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

13. Doa juga bisa digunakan sebagai sarana untuk meminta keberanian dan kekuatan menghadapi tantangan hidup.

14. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

15. Masaya naman talaga sa lugar nila.

16. If you think he'll agree to your proposal, you're barking up the wrong tree.

17. Anong oras gumigising si Cora?

18. Ano bang nangyari? tanong ni Lana.

19. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

20. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

21. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

22. Dala marahil na nakakamit ang lahat kaya may hinahanap si Bereti sa buhay.

23. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

24. Disculpe señor, señora, señorita

25. I have lost my phone again.

26. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

27. Cryptocurrency is often subject to hacking and cyber attacks.

28. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

29. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

30. Kasama ang aking kabiyak, nalalampasan namin ang mga hamon na dumadating sa amin ng may paninindigan at pagmamahalan.

31. Gracias por hacer posible este maravilloso momento.

32. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

33. Nasaan si Mira noong Pebrero?

34. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

35. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

36. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

37. Isang linggo nang makati ho ang balat ko.

38. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

39. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

40. Have you ever traveled to Europe?

41. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

42. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

43. Ang itim mo, Impen! itutukso nito.

44. Gusto kong bumili ng bestida.

45. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

46. Ano ang alagang hayop ng kapatid mo?

47. Binati niya ito ng "Magandang umaga sa iyo".

48. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

49. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

50. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

Similar Words

morena

Recent Searches

moretooltiyakkultursiyaborgeresiguradolangawkagustuhangwealthsumasakitkelangannaglaonvanpitongnyahasboxnakakapagtakaheidonkagipitanknownnaninirahanpagpiliipagpalitnapahacergodbathalaigigiitmasayang-masayamamayaattentionorasegennakakunot-noongmagpahingahumalikbinabaanskilltiniopananakitnobodynagkabungamagpaniwalainantokmaagasapatoskaloobanandresifugaomabangotrainingnasasalinankinakitaannapilihoweveritutuksokagyatpinagkaloobanincluirgalitimpactsfindalammaniladiningmandukotdatungdalihimigsampaguitamessageitspitohinanakitbungangbumilistumingalamaglinissarapdilamarkedulimensaheproyektolayuancadenababasahindiretsahangkaniyanag-uwicakeimikbundokafterpaglinganagkantahanmanysamakatwideasiermayamangmasayang-masayanghubad-baromalambinggayunpamanstoplightaplicacionespopulationgermanymakitakasintahanelectrepresentativesrepresentativedividedmagpapabakunapinalayaskaawayatingmay-aritradenganapakahabanaiinisresultaeksportererhugisagawnakatinginyourlakasmasinopnagsalitamamayangbasahumanoskagatolmaasahanmapagodimpactmakasamasinunud-ssunodnandayakagandahansamang-paladiginawadtag-arawpinagkakaabalahanmag-ingateducationallistahanpalaerhvervslivetmakasarilingdalawsinbetweennadadamaymaibigancompletepinaoperahandropshipping,joshuapag-aaralhabitsbungaddancetelephonelinawwantanubayanamericalifedogstransmitspaperlendingkonsiyertosasagutininiligtasboxingskirthateadvancedkauntingchangegandahanhanap-buhaymakapaniwalabeingnetflixmagnakawterminocitizensnagniningningagricultoreshawaiiwould