Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Emphasis can be used to create rhythm and cadence in language.

2. Sasambulat na ang nakabibinging tawanan.

3. She has excellent credit and is eligible for a low-interest loan.

4. The church organized a charitable drive to distribute food to the homeless.

5. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

6. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

7. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

8. Bigla siyang bumaligtad.

9. Bilang paglilinaw, ang presyo ng produkto ay may kasamang buwis, kaya hindi na ito madadagdagan.

10. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

11. Mas mainit ang panahon kung walang hangin.

12. The store offers a variety of products to suit different needs and preferences.

13. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

14. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

15. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

16. Pangkaraniwang Araw sa Buhay ng Isang Tao

17. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

18. Puwedeng pautang, nanakawan kasi ako?

19. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

20. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

21. Puwede ba sumakay ng taksi doon?

22. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

23. Maganda ang website na ginawa ni Michael.

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Sudah makan? - Have you eaten yet?

26. Ano ang isinulat ninyo sa card?

27. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

28. Sa mga dagok ni ogor, tila nasasalinan pa siya ng lakas.

29. We need to optimize our website for mobile devices to improve user experience.

30. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

31. Kailan niya kailangan ang kuwarto?

32. Ang parusang angkop sa suwail na anak ay iginawad.

33. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

34. Wag mo naman hayaang mawala siya sakin.

35. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

36. Gumagalaw-galaw ang sabog na labi ni Ogor.

37. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

38. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

39. Wala na ang beyblade at ang may-ari nito.

40. Magkapareho ang kulay ng mga damit.

41. Nationalism has played a significant role in many historical events, including the two World Wars.

42. Na-curious ako kaya't nag-google na lang ako upang malaman ang sagot.

43. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

44. I took the day off from work to relax on my birthday.

45. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

46. Tatanghaliin na naman bago siya makasahod.

47. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

48. It's not worth getting worked up over - it's just a storm in a teacup.

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. Ang tugtugin ay may mababa ngunit malalim na tono.

Similar Words

morena

Recent Searches

mariamorekanyaenhederiginawadneed,larawanpag-ibigfistsbagayonkuwartakunwapamamagasupilinknowntapostahanannag-aasikasoteleviewingbayanipamanmagworktelefonereasytinitindacuredkinalalagyanpalapupuntasapagkatorasanfuepagsasalitanatakotyoungpobrengmagta-trabahobantulotsighnaisledsanganiyogalamnayonmaarawmag-aaralattractivebayannakatapatmabaitpedemaaringmagasawanghanap-buhayipinakopatungongmanagergasbilibidkinatatakutanpinaglagablabkuwadernonakaririmarimcultivarclassroomtonnagtanghalianmungkahilarolahatlagnattanghalinaririnigkapatidkamatisakintinawananhirapmaglutomagtatamponewspolvoskamayinterpretingrelevantmanakbojeepneykurbatabranchamingmaghihintayprojectsmagbigaysimbahapagpanawjoseahitnagtatampocombinedperonoongundeniablenagtatakbotangomesabuwanmisahagdanmatamissayapakaingayundinpa-dayagonalpaninginvarietyisulatbecameilawekonomiyagrowthganitomanyibonnagtitinginanhiligbefolkningent-shirtgumisinghanginmatariknapuyatnamanghahalamanganangpakikipaglabanmedpaguutosafteramazongabilittlekalikasannapapikithumblekauntina-fundtinataluntongitaradiwatangbumigaymasayaeksport,pinabayaanscientisthonestokwebangbakantebookstangeksgataspatience,capablemanirahansobrapalusotryanuniqueeducatingpunsodinikeepingaggressiondangeroushubad-barokasakitdiamondsipahiwarecibirtanimanartsmakalingmachinesniyanfrescofaktorer,labingmaskikidkirandelegatedbagsakrisetikettabihanmovingemphasisusegagamitin