Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "more"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "The better I get to know men, the more I find myself loving dogs."

3. "The more people I meet, the more I love my dog."

4. Acts of kindness, no matter how small, contribute to a more charitable world.

5. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

6. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

7. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

8. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

11. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

12. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

13. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

14. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

15. High blood pressure is more common in older adults and those with certain medical conditions.

16. His administration pursued a more confrontational stance towards countries like China and Iran.

17. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

18. I reached my credit limit on the card and couldn't make any more purchases.

19. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

20. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

21. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

22. Jeg kan ikke skynde mig mere end jeg allerede gør. (I can't hurry more than I already am.)

23. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

24. Leukemia can affect people of all ages, although it is more common in children and older adults.

25. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

26. Limitations can be a source of motivation to push oneself to achieve more.

27. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

28. Many people start their day with a cup of coffee to help them wake up and feel more alert.

29. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

30. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

31. Microscopes can magnify objects by up to 1,000 times or more.

32. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

33. Robusta beans are cheaper and have a more bitter taste.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. She started a TikTok account to showcase her art and gain more exposure.

36. Short-term investors may be more focused on quick profits, while long-term investors may be more focused on building wealth over time.

37. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

38. Stocks and bonds are generally more liquid than real estate or other alternative investments.

39. Supporting policies that promote environmental protection can help create a more sustainable future.

40. Sweetness can be used to mask other flavors and create a more palatable taste.

41. The company's CEO announced plans to acquire more assets in the coming years.

42. The company's growth strategy is focused on acquiring more assets.

43. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

44. The information might be outdated, so take it with a grain of salt and check for more recent sources.

45. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

46. The momentum of the protest grew as more people joined the march.

47. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

48. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

49. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

50. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

51. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

52. This has led to a rise in remote work and a shift towards a more flexible, digital economy

53. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. Eating healthy is an important way to take care of your body and improve your quality of life.

2. The United States also has a system of governors, who are elected to lead each individual state

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

5. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

6. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

7. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

8. Kailangan ko ng lumisan mahal ko.

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. His presidency was marked by controversy and a polarizing political climate.

11. You're not being direct. Stop beating around the bush and just say it.

12. Dapat nating bigyan ng halaga ang mga taong nakapaligid sa atin, datapapwat ay hindi natin palaging nakakasama sila.

13. Ang mga pangarap natin ay nagtutulak sa atin upang magkaroon ng mga positibong pagbabago sa buhay.

14. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

15. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

16. She is playing the guitar.

17. Mathematical formulas and equations are used to express relationships and patterns.

18. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

19. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

20. Nakita ko namang natawa yung tindera.

21. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

22. Nagtawanan kaming lahat sa hinirit ni Kenji.

23. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

24. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

25. Iyon pala ay isang diyosa na nagpapanggap lamang.

26. Kahit malayo ka, hindi nawawala ang pagkagusto ko sa iyo. Crush kita pa rin.

27. The feeling of finishing a challenging book can be euphoric and satisfying.

28. Maaliwalas ang simoy ng hangin sa probinsya.

29. I am planning my vacation.

30. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

31. Pupunta kami sa Laguna sa makalawa.

32. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

33. Habang nglalaba si Aling Rosa at iba pang may-bahay ay masayang nalalaro at naliligo ang mga bata.

34. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

35. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

36. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

37. Ang pagdadasal ng rosaryo tuwing alas-sais ng gabi ay isang ritwal na hindi nila kinalilimutan.

38. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

39. Repeated frustration can lead to feelings of hopelessness or helplessness.

40. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

41. La tos puede ser un síntoma de cáncer de pulmón.

42. Sa harap ng mga bisita, ipinakita niya ang magalang na asal ng mga kabataan sa kanilang pamilya.

43. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

44. Magandang umaga po, Ginang Cruz.

45. Magsi-skiing ako sa buwan ng Enero.

46. They travel to different countries for vacation.

47. Mabait ang mga kapitbahay niya.

48. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

49. Les travailleurs doivent respecter les heures de travail et les échéances.

50. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

Similar Words

morena

Recent Searches

moresharksakitfiverrnag-uwipagtatanonggalaktulogpagkaraanconstantlytilgangpagkakayakapmisamarahanrawmaliksitungkoduniversitiesgayunpamankingibalikpaggawakailangangnaisubonaawaiikutanerhvervslivetmulahabangwaldodiliwariwresortaddressgiyeraconclusiondalawadumalobeastmangiyak-ngiyaknakatayopagdiriwangsumakitdioxidekaniyangsinobecomingnakararaanbuslopneumonianakatuklawtools,kulaypagka-datublusatahananalas-diyessundalopagbahingemocionantepaki-basanagmamaktoliilanundasbakedamittrespakikipaglabanmaicoadditionkatapatlumangoypaghangaku-kwentaenduringauthornagkasunognakikitatuloypulubijuliusamazondalawinmayamannegosyantenagsisilbiimpactduriannapakasinungalingmabigyaninakalanewsnagtutulunganiikotseenshopeepagkuwansponsorships,hayopkayotaun-taonpagkahapopinipilitninumanbaliwlumapitaniwasakmabilispuwedeartistsshehandaandurasginagawamarchseryosobangosmahiramtradeallergyaminganakwelyobutterflykundibakitsubalitbulalasmasipagnapilitangbilernitongoraskanya-kanyangipaliwanagkatipunannganiyanimportantesbluenakaraantherapylolakinakaligligkabinataanannikangumingisidaliritinderatutorialsespecializadastuwangnag-aaralpasensiyahierbasmamataannaiinisnaiilangvednararamdamanumupoanyonangyaringayonreguleringwikabumilisawitinherunderkalupipinagkaloobanyumakapsandaliunoinitlabingnagsisikaintugonkatuladmababawbook:kalaroreviselimangcontentnatatawauponmakulongbaku-bakonghafthubadkarnabalsigbayaankabiyaktinamaanditonakauslingnag-ugatulong