Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "tiempos"

1. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

2. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

3. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

4. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

5. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

Random Sentences

1. Auf Wiedersehen! - Goodbye!

2. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

3. Ngunit isang sugatang pirata ang nagkaroon pa ng pagkakataong mamaril bago ito binawian ng buhay.

4. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

5. Napakalamig sa Tagaytay.

6. Ha? Anong konek ng gas sa taong nagugutom?

7. Ano ang inumin na gusto ni Pedro?

8. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

9. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

10. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

11. Las plantas medicinales se utilizan para elaborar remedios naturales y tratamientos terapéuticos.

12. Espero que te recuperes pronto, cuídate mucho y sigue las indicaciones del médico.

13. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

14. La paciencia nos enseña a esperar el momento adecuado.

15. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

16. Scientific research has shown that regular exercise can improve heart health.

17. The students are studying for their exams.

18. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

19. Napakabilis ng wifi sa kanilang bahay.

20. Ano ang ginagawa mo nang nagkasunog?

21. Mabait ang dentista na naglinis ng aking ngipin.

22. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Napatingin ako sa may likod ko.

25. Umiiyak siyang gumuglong sa basa at madulas na semento.

26. This can be a great way to leverage your skills and turn your passion into a full-time income

27. Inumin mo ang gamot nang minsan isang araw.

28. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

29. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

30. Ano ang kulay ng paalis nang bus?

31. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

32. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

33. Nagsisilbi siya bilang social worker upang matulungan ang mga taong nangangailangan ng tulong.

34. Maganda ang kulay ng mga puno sa panahon

35. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

36. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

37. Wala nang gatas si Boy.

38. Me siento mejor cuando me rindo al destino y acepto que "que sera, sera."

39. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

40. Mayroon ka bang kapatid na lalaki?

41. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

42. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

43. Pahiram naman ng dami na isusuot.

44. Unrealistic expectations can contribute to feelings of frustration and disappointment.

45. Sa gitna ng kanyang pagbabasa, nabigla siya sa malakas na kulog at kidlat.

46. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

47. Ilang tao ang pumunta sa libing?

48.

49. Ang carbon dioxide ay inilalabas ng mga tao.

50. The store has a variety of sizes available, from small to extra-large.

Recent Searches

tiemposnakakalasingnagulatkinukuyomalituntuninbulacausesanak-mahirapabstainingpagkaimpaktopaglalaitharingcultivatelecomunicacionesmaasahanmakikikainallowingtuwanggalaantabicellphonenahawakanmundomakasarilingkilaypawiinhigaanabrilikinakatwirandumagundongumokayinterpretingmasukolpeksmanreviewdulipagkamulatpagsidlangagamitexpeditedunosmasarappaalistsakakapainbeforetanodhehetiktok,maghihintaybighanitinataluntonduwendeperpektingnanigasbinitiwanlugawkaniyasinungalingsumakaystruggledumiilingdanceskillclassmateseryosohinatiddoneferrersinigangsorrymakikipaglaromagta-taxiikinasasabikpunung-kahoymakasilongnaglahongnamumutlatinangkadiscoverednahintakutannapaagamaglalabingpinaoperahansynligemarkedsekonomitumamismagsasakajejubinabaratrumaragasangmarumipaki-basanabuhaytinatanonghablabamagsisimulashoppingmerchandisemalawaknanoodbinibilanglabinararamdamannatulalasingerpagkagisingkangritotshirtdilaabaentrycedulaipinikitbalik-tanawconventionalblesspapuntaresourcesdidingcomunesincreasinglymagkamalinakakatabanalagutannanlalamigsasagutinmakakatakasnanghihinamadsalu-salonamumulaklakenergy-coalpagpapasankonsultasyonkinapanayamsalemalayangpagodkantobutihingtillcitizenbalahibomakasalanangkulunganmahiwagapahiramnakitulogkadalasgumuhitdispositivonangapatdangarbansosginawanghagdananculturespatawarintoolreviewersmakakabihirapapalapitlikodkutsaritangbibilhinmaligayadakilangnuevojuegosluneslagunakailanpalibhasaexperience,novembernaiwanmakahirambumotomeansgripolenguajetamanapakahusaydulalargerseekburmascientific1940provetherapymalinispingganamongpanibagongstrengthspasumapitdaang