Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "tiempos"

1. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

2. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

3. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

4. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

5. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

Random Sentences

1. Omelettes are a popular choice for those following a low-carb or high-protein diet.

2. Hindi ko gusto ang taong nagpaplastikan dahil wala naman itong kabuluhan.

3. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

4. La calidad del suelo es un factor clave para el éxito de los agricultores.

5. Nagliliyab ang apoy sa kagubatan, kaya't mabilis na kumalat ang sunog.

6. Ang buhay ay isang mumunting paraiso lamang.

7. Lending money to someone without collateral is a risky endeavor.

8. Huwag po, maawa po kayo sa akin

9. Bakit ayaw mong kumain ng saging?

10. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

11. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

12. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

13. All these years, I have been grateful for the journey and excited for what the future holds.

14. She exercises at home.

15. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

16. Nice meeting you po. automatic na sabi ko.

17. Some people like to add a splash of milk or cream to the beaten eggs for a creamier texture.

18. Hindi maganda ang resulta ng ginawang pag susulit ni Mikaela.

19. El arte puede ser utilizado para fines políticos o sociales.

20. Ang sarap maligo sa dagat!

21. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

22. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

23. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

24. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

25. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

26. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

27. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

28. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

29. Ang mabuting kaibigan, ay higit pa sa kayamanan.

30. Tengo tos seca. (I have a dry cough.)

31. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

32. Marami ang nagpasalamat dahil hindi naging kamukha ng sanggol ang kanyang ama at ina.

33. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

34. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

35. Samantala sa pag-aaral, iniinda niya ang mga pagsubok sa buhay.

36. How I wonder what you are.

37. Frustration can be a normal part of the learning process and can lead to personal growth and development.

38. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

39. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

40. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

41. At minamadali kong himayin itong bulak.

42. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

43. The scientific method involves forming hypotheses and testing them through experiments.

44. I'm on a diet, but I couldn't resist having a small slice of cake.

45. He has bigger fish to fry

46. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

47. Ipinagbibili ko na ang aking kotse.

48. Sana makatulong ang na-fund raise natin.

49. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

50. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

Recent Searches

tiemposmatangkadperseverance,itinulosnapaagilalinabankmalilimutanmaghaponghatinggabigrocerypesosbihasaipinangangakbayaningniyansalbahenatulaksilasinaminamasdangymtodasalakjennyumibigkamoteinstitucioneskaybilislaamangyamankakayananpalamutinagkantahanibinaonsinimulanmaaaritagalogpabalangbinasaalayibinentainihandamayamankelanplasaeclipxekumatokiskedyulmatulisenergistocksumakyatadvancecarmengardensitawtambayankasalkuwebajuansacrificeandreswifiganidtusindvispitoeuphoricadverse1787saidmakaratingresortshopeemakasarilingpaghingipangitcapitalamosupremeletterailmentsreducedsumugodthenpaynamingchavitguardapocamagpuntasumamaasimpedrogisingdollyburgergearpagguhitnakakatulongreportincreasinglymainitpressyearalepyestatransparentlegislativedinimeanduribarriersirogprosperbalebanalsiyamlibaginilingbehindrawipihitboyseenochandowaystiposcandidatedividesworkdayplatformstruewhetherautomaticnapilingworkingpracticesnutsvanbitbitjohnanotheraggressionsummitbroadcastinghellomaratingqualitytumiramagsabirangetaosnagpapaniwalabringingerlindadisfrutarritwalislandpamburanatuwapakikipagtagpololaalanganplanning,nagtutulunganpanunuksopamanhikanantokgagambapinilingnagpapakainamericannagniningningsasamahantumunogmagdilimtinigilkaibangnalulungkotnakilalaiintayinmabihisanagam-agampaskopetsangschoolsparangpasyalookedemocionantediyaryoporangalahasmayamayadiamond18thpinag-usapan