Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

68 sentences found for "nagwo-work"

1. After months of hard work, getting a promotion left me feeling euphoric.

2. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

3. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

4. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

5. Coffee shops and cafes have become popular gathering places for people to socialize and work.

6. Different types of work require different skills, education, and training.

7. Effective communication and teamwork are important for a successful and productive work environment.

8. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

9. Einstein's work also helped to establish the field of quantum mechanics.

10. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

11. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

12. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

13. Einstein's work led to the development of technologies such as nuclear power and GPS.

14. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

15. He drives a car to work.

16. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

17. He is driving to work.

18. He is not driving to work today.

19. He was busy with work and therefore couldn't join us for dinner.

20. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

21. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

24. I am not working on a project for work currently.

25. I am working on a project for work.

26. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

27. I took the day off from work to relax on my birthday.

28. I'm going through a lot of stress at work, but I'm just trying to hang in there.

29. I've got a big presentation at work today - I hope I don't break a leg!

30. If you keep cutting corners, the quality of your work will suffer.

31. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

32. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

33. Instagram has become a platform for influencers and content creators to share their work and build a following.

34. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

35. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

36. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

37. Many people work to earn money to support themselves and their families.

38. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

39. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

40. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

41. Nagwo-work siya sa Quezon City.

42. Ok. Free ka ba after work? Favor lang sana please.

43. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

44. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

45. Receiving recognition for hard work can create a sense of euphoria and pride.

46. Revise and edit: After you have a complete draft, it's important to go back and revise your work

47. She admires her mentor's leadership skills and work ethic.

48. She admires the philanthropy work of the famous billionaire.

49. She does not procrastinate her work.

50. She missed several days of work due to pneumonia and needed to rest at home.

51. She surprised me with a cake on my last day of work to bid me farewell.

52. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

53. Stop crying and pull yourself together, we have work to do.

54. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

55. Technology has also had a significant impact on the way we work

56. The nature of work has evolved over time, with advances in technology and changes in the economy.

57. The relationship between work and mental health is complex and can vary from person to person.

58. This has led to a rise in remote work and a shift towards a more flexible, digital economy

59. Time management skills are important for balancing work responsibilities and personal life.

60. We finished the project on time by cutting corners, but it wasn't our best work.

61. We have a lot of work to do before the deadline.

62. Work can also have a social aspect, providing opportunities to meet new people and make connections.

63. Work can also provide opportunities for personal and professional growth.

64. Work can be challenging and stressful at times, but can also be rewarding.

65. Work is a necessary part of life for many people.

66. Work-life balance is important for maintaining overall health and wellbeing.

67. Writing a book is a long process and requires a lot of dedication and hard work

68. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

Random Sentences

1. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

2. Don't count your chickens before they hatch

3. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

4. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

5. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

6. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

7. Ibinigay niya ang kanyang tiwala sa akin upang mamuno sa proyekto.

8. Buti na lang medyo nagiislow down na yung heart rate ko.

9. Hindi dapat umutang nang labis sa kakayahan ng pagbabayad upang maiwasan ang pagkakaroon ng financial burden.

10. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

11. Emphasis is often used to highlight important information or ideas.

12. May kailangan akong gawin bukas.

13. Pakipuntahan mo si Maria sa kusina.

14. Nationalism can be a source of inspiration for artists, writers, and musicians.

15. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

16. El realismo y el impresionismo son estilos populares en la pintura.

17. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

18. Sumaya ang mundo ni kuya dahil sa iyo.

19. Tengo muchos amigos en mi clase de español.

20. Puwede ba akong sumakay ng dyipni?

21. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

22. Maaliwalas ang simoy ng hangin sa probinsya.

23. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

24. No puedo preocuparme por lo que pueda pasar en el futuro, solo puedo confiar en que "que sera, sera."

25. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

26. Ang mga marahas na laban sa karapatang pantao ay dapat labanan at iwaksi.

27. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

28. Beauty? tanong pa ni Mrs. Lacsamana.

29. A lot of rain caused flooding in the streets.

30. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

31. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

32. She enjoys cooking a variety of dishes from different cultures.

33. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

34. Controla las plagas y enfermedades

35. Natuwa ang mga bata habang pinapanood ang lumilipad na saranggola.

36. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

37. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

38. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

39. Pumasok po sa restawran ang tatlong lalaki.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

42. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

43. Ma, wag mo akong iwan. Dito ka lang ma!

44. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

45. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

46. Ibinigay ni Ana ang susi sa kanya.

47. Ipinahamak sya ng kanyang kaibigan.

48. Sayang, apakah kamu bisa mengambil anak-anak dari sekolah nanti? (Darling, can you pick up the kids from school later?)

49. The professor delivered a series of lectures on the subject of neuroscience.

50. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

Recent Searches

nagwo-workpigilannatitiyakoutlinetugonbababuena00amreporteeeehhhhbathalaonlynenaeducativasbinibilangmanlalakbaynanghihinashopeemagkaparehonapapatungonakahiganghitsuraarmaelminamahalerlindalangitmagkaibangpuntahanmakagawatatanghaliinestasyonsinimulanlever,ibinaonendvidereengkantadanabigyanpasigawtillmahulogdyanomelettemulti-billioneducationalproveparatingdumaramicomputerpagkakapagsalitanaglinismagkasintahannakapangasawabumisitamabihisansaranggolapamilyamaghandamagkabilangintramurosnagyayangmanonooduniversitieskaninamedievalenergye-commerce,kundipaldasmileanghelmaduraslivesmejobefolkningensangjoshginangtinahakproduciruriresearchpdainalalayanhardumaasapumilinotknowsfacilitatingauthorfurthereitherdeclaremerenaghandanapakahusaykakaibangnaka-smirknagsagawamawawalalansanganmatagumpaybumaligtadthroatperseverance,inispangkatpresleysusilarongkanilatignancarbonmakaratingmakasarilingletterpangingiminealinggoresignationkadaratingwalngulamdoktorfeedback,divideslegendsfloortechnologiesandycomunicarsesisidlanageskinauupuannawalangkamakailannagsipagtagohamakpresidentegelaidisyempreperpektoothersisamamalakastuvoparusangmartiandahanvistsofapag-akyatindividuallendingbarfourpinabayaanprodujonagtakamarasigankahonglumilipadalas-tressinipangkontinentenggospelnatutulogautomatisknakitulogguidancesaktankutsaritanghitiktumutubodaliiskopatuloyleadnapalitanganakejecutanhelpedarkilainantaymagnifykulangbusogilogcasaproperlyprocesogisingbellnamingimaginationseparationinvolveemphasisnababakasedit