Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "become"

1. Coffee shops and cafes have become popular gathering places for people to socialize and work.

2. Dogs can develop strong bonds with their owners and become an important part of the family.

3. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

4. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

5. He has become a successful entrepreneur.

6. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

7. Instagram has become a platform for influencers and content creators to share their work and build a following.

8. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

9. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

10. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

11. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

12. Television is a medium that has become a staple in most households around the world

13. The app has also become a platform for discovering new music, with songs going viral through TikTok.

14. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

15. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

16. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

17. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

18. TikTok has become a popular platform for influencers and content creators to build their audience.

19. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

20. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

21. We need to calm down and not let this become a storm in a teacup.

Random Sentences

1. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

2. The Great Wall of China is an impressive wonder of engineering and history.

3. Ang baryo nila ay kilala sa taunang paligsahan ng saranggola.

4. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

5. Ang mga nagliliyab na bulaklak sa hardin ay nagbigay ng makulay na tanawin.

6. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

7. Ang snob naman neto. Alam mo ba kung anong oras na?

8. Saan ka kumuha ng ipinamili mo niyan, Nanay?

9. Mayroon ba kayo na mas malaking size?

10. Who are you calling chickenpox huh?

11. Después de desayunar, salgo a correr en el parque.

12. Kalimutan lang muna.

13. Love na love kita palagi.

14. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

15. Yey! Thank you Jacky! The best ka talaga!

16. Let's just hope na magwork out itong idea ni Memo.

17. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

18. La robe de mariée est magnifique.

19. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

20. Masamang droga ay iwasan.

21. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

22. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

23. Taga-Hiroshima ba si Robert?

24. Doon nila ipinasyang mag honeymoon.

25. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

26. Naku, ang taas pala ng temparatura ko.

27. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

28. Lumiit ito at nagkaroon ng mga mahahabang paa.

29. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

30. Nawalan kami ng internet kaninang madaling araw.

31. Børns sundhed og trivsel bør være en prioritet i samfundet.

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

34. Taking unapproved medication can be risky to your health.

35. En boca cerrada no entran moscas. - Silence is golden.

36. Ang bakuna ay lubos na nakakatulong kontra sakit.

37. Oo. Pero kelangan.. susunod ka lang sa akin, ok ba yun?

38. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

39. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

40. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

41. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

42. Kinilig ako pero di ko pinahalata, whatever.

43. Nakita ko ang kanyang halinghing na unti-unti nang bumibilis dahil sa takot.

44. He forgot his wallet at home and therefore couldn't buy lunch.

45. Ano ang ginagawa niya sa gabi?)

46. No tengo apetito. (I have no appetite.)

47. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

48. Ano ang inumin na gusto ni Pedro?

49. Nag-email na ako sayo kanina.

50. El color y la textura son elementos fundamentales en la pintura.

Similar Words

becomes

Recent Searches

binawibecomeweddinglosspeacebeginningmonetizingstagedanceredcandidatepressdidinglungkotsalarintissueknowledgepublishedgeneratedskillnutshapdihapasinsquatteropokayonakabiladmagbigaymakapagempakenakalipascalciumnaabutantanyagencompassesubomedya-agwabrightkantoleadingangkopsandokgitarakausapinyayaboracaybowlmagpapagupitunapondokumustamonumentonakauwideterminasyonkaramimakapasaartistnag-umpisapangitdeletinungofinalized,naiinggittsuperpasensiyamagagandapangilguhitsinohinawakanbayanpwedeabalanumerososmayamannapadpadtumutuboeuphoricpelikulaparkinganghelfrescoganidginagawainvitationkangpagluluksanagtatrabahonakakapamasyalpagkalungkoteskuwelahanmanbusynakaraangfuelnahawakansalepinakamatapatpodcasts,saranggolahealthiernapapalibutanpinagpatuloymagpaliwanagnakatunghaynakikilalanglalakadcancermagkakaroonnanlalamigkarwahengcultivarmakakakainnaghuhumindigtravelnegro-slaveslumiwagkamiastahimikyumuyukonareklamomakuhanakasakitkidkiranpinapataposencuestaslumakaskangkongbangkangtungopinansintumaposipinauutangstorysagutinnangapatdandropshipping,guerreropantalongparusahanbarrerascantidadpagbatiasukalpropesorbihirangmahahawakarapatangmahigpitnatutuwaumigibshadeswakasemocionalipinansasahogtatlongmabigyanmensnagwikangstreetlipatrabbawikaforskelkinalimutanbaguiojobnapadaancompletamentee-commerce,lumutanglenguajeartistsilawgiverbangkoiconspaksanetflixtibigtinitindapublishing,blusaasonakatingingbigoteredigeringgeneanywheregabrielboholbutchseniormahahabangseekpedroamongrhythmibigbisigmemo