Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "become"

1. Coffee shops and cafes have become popular gathering places for people to socialize and work.

2. Dogs can develop strong bonds with their owners and become an important part of the family.

3. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

4. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

5. He has become a successful entrepreneur.

6. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

7. Instagram has become a platform for influencers and content creators to share their work and build a following.

8. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

9. LeBron's impact extends beyond basketball, as he has become a cultural icon and one of the most recognizable athletes in the world.

10. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

11. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

12. Television is a medium that has become a staple in most households around the world

13. The app has also become a platform for discovering new music, with songs going viral through TikTok.

14. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

15. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

16. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

17. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

18. TikTok has become a popular platform for influencers and content creators to build their audience.

19. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

20. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

21. We need to calm down and not let this become a storm in a teacup.

Random Sentences

1. Mahal ko ang pusa ko dahil malambing siya.

2. Marami rin silang mga alagang hayop.

3. Mabait siya at nanggagamot siya nang libre.

4. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

5. Eine klare Gewissensentscheidung kann uns ein gutes Gefühl geben und unser Selbstbewusstsein stärken.

6. The victim's testimony helped to identify the culprit in the assault case.

7. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

8. Hindi mo na kailangan ang magtago't mahiya.

9. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

10. Rektanggulo ang hugis ng mesa namin.

11. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

12. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

13. Sandali lamang po.

14. Sa Manila Hotel ka titigil, hindi ba?

15. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

16. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

17. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

18. Nag-aalala ako para sa kalusugan ko, datapwat hindi pa ako handa para sa check-up.

19. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

20. A successful father-child relationship often requires communication, patience, and understanding.

21. El agricultor contrató a algunos ayudantes para cosechar la cosecha de fresas más rápido.

22. I am not exercising at the gym today.

23. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

24. There are so many coffee shops in this city, they're a dime a dozen.

25. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

26. Nagluto ako ng adobo para kina Rita.

27. Sumapit ang isang matinding tagtuyot sa lugar.

28. She is not playing with her pet dog at the moment.

29. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

30. Nasaan si Mira noong Pebrero?

31. Bersatu kita teguh, bercerai kita runtuh.

32. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

35. Min erfaring inden for dette område har været meget givende.

36. Habang tumatakbo siya, tila lalong palayo ang kanyang mga pangarap.

37. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

38. Hindi ko nais makialam, ngunit sa ganang iyo, tama ba ang naging hatol ng hukuman?

39. Ang dentista ay maaaring magbigay ng payo tungkol sa tamang pagsisipilyo at pagsisinok ng ngipin.

40. We have a lot of work to do before the deadline.

41. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

42. He has written a novel.

43. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

44. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

45. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

46. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

47. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

48. The king's court is the official gathering place for his advisors and high-ranking officials.

49. Sa pagpapahalaga sa ating kalayaan, kailangan din nating bigyan ng halaga ang kalayaan ng iba.

50. All these years, I have been chasing my passions and following my heart.

Similar Words

becomes

Recent Searches

menosanimoybecomemeaningbegandulotremainexcusesolararbejderkasyapyestaimaginationhanlackkamatisestablishabonoseekorasasulcontestakingbroadcastcommerciallikelybeginningtipiddulahalikaeyefatalpinunititimmulti-billionabstainingelectionhighestwithoutclockinternaconsiderayanonlyrecentthoughtsnaggingclientessiguronamulatkwenta-kwentavitaminsnanlilisikt-shirtpresidentenakabluenakitapagimbaynagpapaigibtagpiangpisarakaraniwang3hrsanongtengalorenamaghandacompositorespulisdollariilanbaropusonabahalapisinakapagngangalitnagtatakabahaynungatensyongnapasigawtheypinagawamanahimikmagkakaanaknagawangnabalitaanmadungisnagbibirotahananpaninigasnakaakyatbilihinbarcelonaorganizepasensyamarketplacespakealampancitsetyembredisappointcigarettevehiclesmasungitstylesshiftsecarseparaisoumakbaytumiranailigtasistasyonmasyadongkumakantakissumuwisinasabimontreallumalangoytalinonatitiyakjeepneysubject,kapataganpigilanattorneynglalabasinodiferentespinagalitancultivonagpakitanagpapasasamaglalakadrevolucionadomakapaibabawnamumuongkastilamagbabagsiknawalangeskwelahannagpipikniknakasandigpagpapautangnakahigangpulang-pulanakakasamanagmamadalinovelleshiwapagtutolgandahantiktok,humiwalaynalagutannagpakunothahatolpabalingatperpektingcompanieskaliwabakantehinanakitmarasigantumatakbocardiganplantasmaabutanmakingtwo-partyginanagwikangundeniablehelenaunconventionalandreasementohirambagamatlunasganapparasinungalingnaalisturonkumapitdialledminamasdanmagsimulaangelamaibabalikganyanangalinvitationreviewlilykutodcareerfiverrphilippine