Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "negative"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

3. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

4. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

5. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

8. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

9. Nationalism can be both a positive force for unity and a negative force for division and conflict.

10. Negative self-talk and self-blame can make feelings of frustration worse.

11. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

12. The feeling of frustration can lead to stress and negative emotions.

13. The pursuit of money can have both positive and negative effects on people's lives and relationships.

Random Sentences

1. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

2. Laughter is the best medicine.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Masarap ang pagkakaluto mo ng kare-kare.

5. Don't underestimate someone because of their background - you can't judge a book by its cover.

6. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

7. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

8. The surface of the hockey rink is made of ice, which can be slippery and challenging to navigate.

9. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

10. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

11. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

12. Ikaw na nga lang, hindi pa ako nagugutom eh.

13. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

14. Thank God you're OK! bulalas ko.

15. Aalis na nga.

16. Di na ako magtataka dahil alam ko naman ang nangyari.

17. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

18. Después de estudiar el examen, estoy segura de que lo haré bien.

19. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

20. Ano ang gagawin mo sa Linggo?

21. Nagka-cutting classes ako kanina dahil biglaang nagkasakit ako.

22. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

23. The art class teaches a variety of techniques, from drawing to painting.

24. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

25. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

26. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

27. Wala na siguro sya, baka natulog na inantok na.

28. Sa facebook ay madami akong kaibigan.

29. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

30. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

31. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

32. ¿Dónde está el baño?

33. Sa droga, walang kasiguraduhan kundi kamatayan.

34.

35. Sino ang doktor ni Tita Beth?

36. Einstein was a vocal critic of Nazi Germany and fled to the United States in 1933.

37. Sinabi naman ni Apollo ang mga dapat gawin.

38. La obra social produjo una gran ayuda para los más necesitados.

39. Sa harap ng outpost ay huminto ang pulis.

40. Kakutis ni Kano ang iba pa niyang kapatid.

41. Nagliliyab ang apoy sa kagubatan, kaya't mabilis na kumalat ang sunog.

42. Ang pagiging maramot sa pagmamahal ay hindi magdudulot ng kasiyahan sa buhay.

43. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

44. Wala pa ba? seryoso niyang tanong.

45. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

46. Ang sarap maligo sa dagat!

47. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

48. Ibinigay ng titser ang libro sa estudyante.

49. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

50. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

Recent Searches

aggressionpilingnegativehimigipihitfacultymensajesnanlilisikmahawaanpinapasayamakikipag-duetogobernadorkinikitakinagalitankapatawaranpagngitimakapaibabawpagkakapagsalitaescuelasjackmagpagupitmahinanakasakittindalalakadpagkainisnakatagopaki-drawingnakikitanggovernmentculturefitnessmakapalaghumiwalaynagmistulangmagkaibangeksempelnalugodmasaktanintramuroskuripotpaoskapitbahaytumigildiyaryokanginapagkaawaumigtadjingjingpaparusahanfysik,naghihikabnagtataelikodcaracterizapigilanmagselospatakbongnapawiisasamakampanatrentapinansinnakangisinggovernorscosechar,vedvarendeiniirogisusuotngititog,mananaogkinagabihaniskedyultusongpanatagginoongendvidereipinansasahoglakadhanapinhinatidkastilagusalipisaradesign,barcelonalandasnaantigsurveyspaliparinmaynilasoondailynahihilomarmaingbumotosetyembrehopemagisinginiibiginatakekindssalatnahigainvitationkatapatchickenpoxambagkaugnayancompositoresasaltapatpagtatanimbagalkirotbulongangaltomorrowcampaignspnilitkainanmagsimulakutsaritangsikattmicadalawangengkantadamatangkadkumaenawitindagaideassparkwidespreaddyanpakelamhumanolorddettebagodalandansubalitmestlayasclasesbusiness,kantoclientssantopanguloniyonbumabadadapaslitharddidingchamberspupuntanagingpinunitposteraddresshitprovenaritocoinbasemacadamiaadventjerryipinabaliknagtagpomagbubungacorrectingechavefiguredownschoolparatingbabedollarbeenadditionallycigaretteislaochandofascinatingbringcesyearpagdudugojuegosbirohinagud-hagodmanakbonanunuritinakasanpoorernagtitindataxi