Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "negative"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

3. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

4. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

5. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

8. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

9. Nationalism can be both a positive force for unity and a negative force for division and conflict.

10. Negative self-talk and self-blame can make feelings of frustration worse.

11. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

12. The feeling of frustration can lead to stress and negative emotions.

13. The pursuit of money can have both positive and negative effects on people's lives and relationships.

Random Sentences

1. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

2. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

3. Musk has been married three times and has six children.

4. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

5. Niluto nina Tony ang isda sa kusina.

6. Dette er med til at skabe en høj grad af social tryghed for befolkningen, og det er også med til at sikre, at Danmark har en lav arbejdsløshed

7. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

8. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

9. The dog does not like to take baths.

10. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

11. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

12. Naranasan ko na ang agaw-buhay na pakikipaglaban para sa aking mga pangarap.

13. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

14. Hockey is played with two teams of six players each, with one player designated as the goaltender.

15. Viruses are small, infectious agents that can infect cells and cause diseases.

16. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

17. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

18. Pero bigla na lang siyang hindi nagpakita.

19. Sige, tatawag na lang ako mamaya pag pauwi na ko..

20. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

21. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

22. Sa mga matatandang gusali, naglipana ang mga alamat at mga kuwento ng nakaraan.

23. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

24. Bukas na daw kami kakain sa labas.

25. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

26. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

27. He practices yoga for relaxation.

28. Está claro que el equipo necesita mejorar su desempeño.

29. Gaano kalaki ang bahay ni Erap?

30. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

31. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

32. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

33. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Don't spill the beans about the project, it's supposed to be a secret.

36. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

37. Kung hei fat choi!

38. The artist's intricate painting was admired by many.

39. Kay hapdi ng kanyang batok at balikat.

40. A couple of friends are planning to go to the beach this weekend.

41. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

42. Ang mga magulang ay dapat maging maingat sa pagbabantay sa kanilang mga anak upang maiwasan ang paggamit ng droga.

43. Gusto kong manood ng mga pambatang palabas.

44. The wedding cake was beautifully adorned with fresh flowers.

45. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

46. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

47. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

48. Den danske økonomi er bygget på en kombination af markedsekonomi og offentlig regulering

49. Natawa si Aling Marta at pagkaraan ay dumukot sa bulsa ng kanyang bestido upang magbayad.

50. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

Recent Searches

negativepag-asabangladeshbukodkangkongcommunicatematayogtumamainternetniyomahiwagangnatutulogdunmealbituineventosapatnapupaskohelenapulissutilmagtanghalianbibigprocessmaatimestoseasysourcesitinaponnakapagsalitaindustriyastreetmahiwagasasakaytumindigambagmemberstumabisiglapaglulutomakikipagbabagmagka-apomanggagalinghamaksuchsighalexanderconditioningforskel,andresantoalaganapasigawtumawanaawanapoculturalcoalseryosobutaskausapinpasalubongbinulabogchoiceatensyongseryosongnagdarasalkumidlatmaintindihaneksperimenteringmaicomemorialpetroleumnangingisaylapissharkmag-alalahinding-hindiraisedsumagottagalogtalentedtolnag-eehersisyotwitchmagtakapag-aaraljodiefull-timenakarinigdali-dalingnaminggarciacelularesanayparingdisciplinlakasmedievalsigetanghalielektroniksapacompletingmalalapadstudyduwendelegacymagturoilihimbagaycommunitybiyaskumainthanksgivingnag-alalatagahumingadullitinalirenacentistamagdaanpanahonhardinmaghahatidinternalboymasasakitsyncdoble-karafactoreskikomikaelaconsideredsaan-saanbasket1940nakakapamasyalsecarsepaglayasmaestrainantokspeedkinakainmuyhardthroughouttinigilanmakatiyakchristmaspagamutangustobwisitaddictionmahabadistanciaswimmingkonsentrasyontubigmagpapapagodipinahamakbilibiduniversaltodopagkakayakapattackexistsoportesumasaliwhimayinmagkakasamalibromagbigaymatustusanisinumpahalakhakkanya-kanyangsinatinawananisusuotkasalnagpakitavorespananghaliancoincidenceyarikumirotsiranagalitmagpa-ospitalmababawwaitbayabassinalansanimagingayatrascienderiskginawaranfeedback