Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "negative"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

3. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

4. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

5. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

8. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

9. Nationalism can be both a positive force for unity and a negative force for division and conflict.

10. Negative self-talk and self-blame can make feelings of frustration worse.

11. Some critics argue that television has a negative impact on children, as it can lead to decreased attention spans and a lack of physical activity

12. The feeling of frustration can lead to stress and negative emotions.

13. The pursuit of money can have both positive and negative effects on people's lives and relationships.

Random Sentences

1. Hindi ibibigay ng Panginoon sa iyo ang isang pagsubok kung hindi mo ito kaya, magtiwala at maniwala ka lang sa Kanya.

2. Ngumiti ako saka humalik sa mga labi niya.

3. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

4. Sa harap ng kahirapan, ang mga mahihirap ay nag-aapuhap ng tulong mula sa mga non-profit organizations.

5. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

6. Tumindig ang pulis.

7. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

8. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

9. Después de hacer ejercicio, me gusta darme una ducha caliente.

10. Pumunta ang pamilyang Garcia sa Pilipinas.

11. Naaalala mo pa ba noong tayo pang dalawa.

12. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

13. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

14. Ada berbagai macam jenis doa, seperti doa harian, doa syukur, doa permohonan, dan lain sebagainya.

15. Huwag daw niyang papansinin si Ogor.

16. Saka dalawang hotdog na rin Miss. si Maico.

17. Bitcoin is the first and most well-known cryptocurrency.

18. Nag smile siya sa akin, at nag smile rin ako sa kanya.

19. Walang bagay na di makita at agad tinatanong ang kanyang ina.

20. The police were trying to determine the culprit behind the burglary.

21. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

22. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

23. Revise and edit: After you have a complete draft, it's important to go back and revise your work

24. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

25. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

26. My coworkers threw me a surprise party and sang "happy birthday" to me.

27. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

28. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

29. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

30. Ang pagbibingi-bingihan sa mga argumento at ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

31. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

32. Makikiligo siya sa shower room ng gym.

33. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

34. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

35. Ang pangalan niya ay Mang Sanas.

36. Nag-asaran, naglokohan at nagtawanan sila.

37. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Ang mga kawani ng gobyerno nagsisilbi sa publiko upang mapabuti ang serbisyo ng kanilang ahensiya.

40. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

41. Påsken er også en tid, hvor mange familier samles og fejrer sammen.

42. Ang ASEAN Summit ay dinaluhan ng mga pangulo ng iba't ibang bansa.

43. Einstein's writings on politics and social justice have also had a lasting impact on many people.

44. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

45. Knowledge is power.

46. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

47. Women have shown remarkable resilience and strength in the face of adversity and oppression.

48. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

49. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

50. Wala kang kuto noh? nabigla ako ng magsalita sya.

Recent Searches

everynegativenerissamonetizingcleansafefullsumalamahihiraptumulongkauna-unahangbahagyangbangkangkatabingtenganakataposkulisaphinipan-hipanmakapalenforcingsetsestadosatenaghilamosinterviewinggaprequireentryinteractcuandoincludemakespackagingyakapsumayalalimambagikinamatayclientspinahalatapinagsulatrevolutioneretutak-biyauncheckedkapitbahaykinauupuaninirapanakinhouseholdpresidentedebatessanaygelainawalapagmasdannakainkahaponadangginaganoonmendiolajoearghhuertomagulayawipagamotinterestalapaapsang-ayonipinagbibiliwalkie-talkiedarkrelevantfourmulingpinipilittag-ulanlahatabalaforskelsayawannakakainsuriinagaw-buhaymasayahinaniibonbeyondnagkantahanbigasnamataypayapanghydelknow-howdamdamindecisionsmatagpuansinasabideterminasyonipinatawnicoparkekinsemagisingsitawhomepigingkasaysayanmalihispongkapegamitoktubreumiwasmaipapautangmagkasintahanmusiciankomunikasyonnakakabangont-shirtnalulungkotkwenta-kwentapinagsikapannawawalamakasilongsasabihinpalabuy-laboynagkapilatnagkasunoginakalanglumikhaturismopaglalaitnagpabotpalaisipandiretsahangtitapagkasabiuugod-ugodmagpapagupitteknologibusinessespinuntahanumagawkahongkaninumanlumiboto-onlineintindihinmagtakalumamangmahiyatakeskapangyarihannasaangkaliwanabuhaymahaboltagpianglot,skirtnakabluepagbebentamaghapontuwidnagbibigayanvaliosatanghalimanakbonagtaposnewsnasilawtsismosanaguusapinstrumentalsumakaysoccerutilizanbenefitskaninaibabawgumisingnatakottraditionalitinaobsaktanmagpakaramiigigiittibigalasphilosophicalkargangnagisingtinitindamarangyangjennygrowthnormalrepublicanshoppinglaamang