Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "once"

1. Format your book: Once your book is finalized, it's time to format it for publication

2. He juggles three balls at once.

3. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

4. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

5. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

6. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

7. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

8. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

9. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

10. Once upon a time, in a faraway land, there was a brave little girl named Red Riding Hood.

11. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

12. Promote your book: Once your book is published, it's important to promote it to potential readers

13. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

Random Sentences

1. Huwag ka nanag magbibilad.

2.

3. Nag-aapuhap siya ng dispensa mula sa simbahan para sa kanyang mga nagawang kasalanan.

4. Hindi malaman kung saan nagsuot.

5. Binigyan niya ng kendi ang bata.

6. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

7. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

8. May nagbigay sa amin ng biglaang free food sa opisina kanina.

9. Ngunit marumi sila sa kanilang kapaligiran.

10. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

11. Hindi ko kinuha ang inyong pitaka.

12. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

13. Magkita tayo sa parking lot ng Luneta Park.

14. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

15. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

16. Salamat na lang.

17. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

18. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

19. Scissors can be sharpened using a sharpening stone or taken to a professional for sharpening.

20. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

21. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

22. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

23. Lumuwas si Fidel ng maynila.

24. The teacher explains the lesson clearly.

25. Hindi maganda ang kanilang plano kaya ako ay tumututol dito.

26. Baka nga si Amba pa gumawa ng tela aniya.

27. The company’s momentum slowed down due to a decrease in sales.

28. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

29. Kung walang tiyaga, walang nilaga.

30. Pero gusto ko nang umuwi at magpahinga.

31. The authorities were determined to find the culprit responsible for the environmental damage.

32. Laughter is the best medicine.

33. Ailments can be managed through self-care practices, such as meditation or physical therapy.

34. Ang kanyang ama ay isang magaling na albularyo.

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

37. Tila may nagseselos sa bagong kasapi ng grupo.

38. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

39. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

40. Børns leg og kreativitet er en vigtig del af deres udvikling.

41. The reviews aren't always reliable, so take them with a grain of salt.

42. Nag-aaral tayo ng Tagalog ngayon.

43. Maraming taong sumasakay ng bus.

44. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

45. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

46. A veces tengo miedo de tomar decisiones, pero al final siempre recuerdo "que sera, sera."

47. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

48. Isang Pinoy ang nanalo sa international singing competition.

49. Tingnan natin ang temperatura mo.

50. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

Similar Words

concernconcernsconcentracientonces

Recent Searches

onceakmangairconkalabawmasayang-masayabelievedroughpatutunguhanbiocombustiblesmagpa-checkupkalarokarununganmerlindananlilisikpasensiyacourtpagkabuhaytig-bebentemagkasakitdiwatasalbahengnagtagalpisaracultivationplantasexpertproudcandidatesmagtanimheartbeatpsssbalotcompositoreskahitpopularizemansanasmakahingiiconicmoodpakainkantabroadcastfuelmasterjerryyestodayprobablementecommercialsellingmongdollarcongratsintonag-aalayabskapilingexamplebakekakuwentuhannagtagisannalalamannamumulotpinapanoodisulatuugod-ugodnakatalungkomahinoglumuwasbitawansteerinuulcerunidosconocidosipinikitrosesumisidlimitedproductividadsoundflavioitinagofreelancersinikapclassroomstudentsdireksyontomyangcalldinaladoble-karamanagerinteriorroquenakaririmarimnasasabihannakapaligidpresidentemaglalaropagdatingdollykarwahengerhvervslivetaloklandbrug,nakaraanmamahalinmaasahanpeksmaninagawmallsnatayoagostotherapeuticskakayananvariedadmagdilimgulangnapatinginchoosehetosalitangscalemalihissalarinfatalmapadalikasinggandapaslitataquesnilutoyelosarisaringinuminseennagkakakaincompanieskawawangnagpalalimkalyenamulaklaksasakyanpinabulaananghumannabubuhaynakatindigtumikimukol-kaysabihinkasalukuyanmagdaraosiyamotnatigilananumangroofstockparurusahanbopolstaingaubomabilisprofoundasimmemorialnilinishapasincualquiermaligayagamespakanta-kantangenfermedades,inakalanasiyahantumigilmagpapigilamericaboxtamarawsiopaoniyognabiglarevolutionizedemocionalrosellenapapasayamatindingitutolexistprovidegenerabalalakitiktok,culturenakaliliyongnagliliyabna-fundkamiaspagkuwannaglokopanghihiyang