Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "need"

1. A lot of people volunteer their time and resources to help those in need.

2. Adopting a pet from a shelter can provide a loving home for an animal in need.

3. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

4. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

5. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

6. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

7. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

8. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

9. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

10. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

11. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

12. I don't want to beat around the bush. I need to know the truth.

13. I need to check my credit report to ensure there are no errors.

14. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

15. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

16. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

17. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

18. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

19. Necesito ver a un médico. (I need to see a doctor.)

20. Not only that; but as the population of the world increases, the need for energy will also increase

21. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

22. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

23. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

24. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

25. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

26. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

27. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

28. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

29. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

30. The elephant in the room is that the company is losing money, and we need to come up with a solution.

31. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

32. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

33. The website's search function is very effective, making it easy to find the information you need.

34. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

35. We need to address the elephant in the room and discuss the budget issues.

36. We need to calm down and not let this become a storm in a teacup.

37. We need to get this done quickly, but not by cutting corners.

38. We need to optimize our website for mobile devices to improve user experience.

39. We need to reassess the value of our acquired assets.

40. You need to pull yourself together and face the reality of the situation.

Random Sentences

1. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

2. He is driving to work.

3. Helte findes i alle samfund.

4. Aling bisikleta ang gusto niya?

5. El autorretrato es un género popular en la pintura.

6. Women have shown remarkable resilience and strength in the face of adversity and oppression.

7. Chumochos ka! Iba na pag inlove nageenglish na!

8. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

9. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

10. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

11. Ang ganda ng bagong laptop ni Maria.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Ang marahas na paggamit ng teknolohiya, tulad ng cyberbullying, ay dapat itigil at parusahan.

14. Ano ang mga ginawa niya sa isla?

15. Mabuhay ang bagong bayani!

16. Kung maka-yo 'tong next partner ko kala mo taga kanto.

17. Isa sa nasa pagamutan na iyon si Bok

18. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

19. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

20. Mayroong maraming tradisyon sa kasalan, tulad ng pagsusuot ng puting damit at paglalakad sa altar.

21. Nagpunta ako sa theme park kasama ang mga kaibigan ko kaya masayang-masaya ako ngayon.

22. Football is a popular sport for both men and women, with many professional women's leagues around the world.

23. Hindi ako sang-ayon sa pag-uugali ng ilang mga kabataan ngayon.

24. Kailangan ng mas magandang kondisyon sa trabaho para sa mga anak-pawis upang mapabuti ang kanilang kalagayan.

25. Ginaganap ang linggo ng wika ng Agosto.

26. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

27. Mga mangga ang binibili ni Juan.

28. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

29. Ang COVID-19 ay laganap sa buong mundo.

30. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

31. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

32. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

33. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

34. Hindi siya maarte sa kanyang damit, ngunit sa kanyang mga aksyon ay makikita mo ang kanyang kahalagahan.

35. The app has also become a platform for discovering new music, with songs going viral through TikTok.

36. The cake was a hit at the party, and everyone asked for the recipe.

37. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

38. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

39. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

40. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

41. Has he spoken with the client yet?

42. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

43. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

44. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

45. "Dogs are not our whole life, but they make our lives whole."

46. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

47. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

48. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

49. Nagitla ako nang biglang bumukas ang pinto ng selda at lumabas ang preso.

50. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

Similar Words

needsneedlessneed,

Recent Searches

armedneeddividesuminomaletiboknapilitangkaraniwangngipingmauntogkatolikoimportantemagandakaarawankutsaritangcarloiigibkasoymatamanpinalayasnakatinginpamamahingabilimanghuliedsapamimilhingproducts:presleysakinabonocompostelacontestpieces1000layaslabisataquesipipilitlegislativeginisingdolyarbinigyangfratelecomunicacionesmagkasing-edadhaftpinapagulongmagkipagtagisaninilagayrocktinaposnatulalasellingmandukotmakapasokmagbibitak-bitakbabalikpagsigawmakalawakanyangiwananinaminpinagtagpobumaligtadbaittransportationfeedback,dioxidepusonglender,occidentalmapapansinnamumuongkampanahinabihelpfulfreelihimfencingalimentonangampanyalikelylawaykutohimutokhigh-definitionforskelligedraft:bigkistennisambat-shirtsalarinnaglahonag-poutmrsmanatililintakasalhinanapevilagastaysamuproductividadmasagananglandema-buhaylalakekakilalakailangansupilininspirasyonguidecaraballobutikilittlebumagsakbegankahirapanadicionalestinanggapsonidopapuntangnakukuhakisapmatakayokagandahanadvancementgagawinsapatoscultivationintroducematalinobuhayhulumbricospinuntahandulotsimbahanhinampasaaisshnenacomputerslindolnakalimutansikippagkamanghaninyogulatnagsuotprobinsiyacountriesnakilalakinikilalangpinangyarihanaffectbunutanfialamangbobosurgeryfargenerabaraisedkaagawpinakamaartenglangawricanakikiatumunogumanomasikmuranakaupomakasilongnagpagupitnagreplyalamnabuhaydepartmentkumantalagaslaskalagayanulapdiliginisubosorrynasasakupanrecibirmalawaksandalishoppingklasengdagatfonoswalkie-talkieerapglobalferreraudio-visually