Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

40 sentences found for "need"

1. A lot of people volunteer their time and resources to help those in need.

2. Adopting a pet from a shelter can provide a loving home for an animal in need.

3. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

4. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

5. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

6. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

7. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

8. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

9. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

10. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

11. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

12. I don't want to beat around the bush. I need to know the truth.

13. I need to check my credit report to ensure there are no errors.

14. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

15. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

16. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

17. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

18. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

19. Necesito ver a un médico. (I need to see a doctor.)

20. Not only that; but as the population of the world increases, the need for energy will also increase

21. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

22. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

23. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

24. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

25. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

26. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

27. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

28. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

29. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

30. The elephant in the room is that the company is losing money, and we need to come up with a solution.

31. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

32. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

33. The website's search function is very effective, making it easy to find the information you need.

34. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

35. We need to address the elephant in the room and discuss the budget issues.

36. We need to calm down and not let this become a storm in a teacup.

37. We need to get this done quickly, but not by cutting corners.

38. We need to optimize our website for mobile devices to improve user experience.

39. We need to reassess the value of our acquired assets.

40. You need to pull yourself together and face the reality of the situation.

Random Sentences

1. The little girl dressed up as a pretty lady for Halloween.

2. Nasaan ang Katedral ng Maynila?

3. Les banques jouent un rôle clé dans la gestion de l'argent.

4. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

5. Paborito ko kasi ang mga iyon.

6. Oo malungkot din ako. Mamimiss kita.

7. Nag-aral kami sa library kagabi.

8. Ano ho ang ginawa ng dalawang babae?

9. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

10. Gusto ko na umuwi ng Pilipinas.

11. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

12. Humihingal at nakangangang napapikit siya.

13. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

14. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

15. Ano ang tunay niyang pangalan?

16. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

17. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

18. He has written a novel.

19. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

20. Have they made a decision yet?

21. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

22. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

23. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

24. Naalala nila si Ranay.

25. Nakangiti sya habang nakatayo ako at nagtataka.

26. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

27. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

28. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

29. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

30. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

31. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

32. Masamang droga ay iwasan.

33. Frustration can also be caused by interpersonal conflicts or misunderstandings.

34. El atardecer en el mar es un momento sublime que muchos aprecian.

35. Tesla is an American electric vehicle and clean energy company.

36. Ang mga ngipin na hindi naipapatingin sa dentista ay maaring magdulot ng iba't ibang sakit sa bibig.

37. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

38. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

39. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

40. Naglaro sa palaruan ang mga bata nang limahan.

41. Ano ang ilalagay ko sa kusina?

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Helte kan have en positiv indflydelse på hele samfundet.

44. Ayos lang ako. Ipapahinga ko lang ito.

45. She has been baking cookies all day.

46. Sa Manila Hotel ka titigil, hindi ba?

47. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

48. Ayaw mo pa ba? tanong niya na nagpakunot sa noo ko.

49. I don't want to beat around the bush. I need to know the truth.

50. Hindi malinis ang mga tsinelas ni Lori.

Similar Words

needsneedlessneed,

Recent Searches

needpagtayosagutintiemposskabttumalikodunahinsabernakikitatalentalignsbastamakamitjacky---maestratumubongsurroundingspagtangomagtatagalkasoyjingjingmandirigmangbakenagpasyaika-12effektivhigpitanwiderewardingnoelpopulationgainschoolsfrasoportepagtumawagnagtatanimniliniskasamaangmoremalayanginimbitabahanagdiskoprivatefounddevelopedsakanagtagpopinag-usapanmasyadongkoreankumalantogmagsunogpumilipagkahapokumidlatfindtaongpulisbinigaynaupobesessharepagkakilanlanphilosopherdraft:drewpitumponggospelinaapimamanhikanenergikumakainkaninounfortunatelypanibagongkinatatayuankinapanayamkumbentonilolokowinghangaringmagsasalitamusiciansmagbubungamahigitdedicationluiskargangsilyamapahamaknakapikitopisinaikinakatwirannagbababadrawingamericaaniumalistonightuniversityexpresanbalikatbestidadespitebateryabipolarkilonguponitimmaramiannikatuloyhinagiskampogregorianomakainmusiciansamantalanggawabumangonherramientasnapabayaanumiibigmerlindapinakainpakakasalanpantalonbehaviorcountryhallmediatechnologytotoongbusilakasawataga-hiroshimagutomkinakailanganexperts,tryghedkuwentoarawdingdinghitlabingmaingatrenatotingdinalanaskumembut-kembotinsteadmalumbaysumpainmakipagtagisanpaglalayagkaliwangmelvinpaaralanmaya-mayapamumunobeastnapapatinginstringtoldifferentnapahingaisaacpagsasayaspreadkainanalituntuninsabaykamalianmapagbigaypotentialkatuladlasonggasolinapaglapastangankemi,masayaschoolnaulinigannakabanggapinanawanlasingipinagbilingechavebinulabogjeepneydiplomahalakhaksmallbagaycubalayaw