Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. The baby is sleeping in the crib.

2. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

3. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

4. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

5. Limitations can impact one's career, relationships, and overall quality of life.

6. Los héroes son ejemplos de liderazgo y generosidad.

7. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

8. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

9. Has she taken the test yet?

10. Pupunta lang ako sa comfort room.

11. Bakit wala ka bang bestfriend?

12. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

13. I love you, Athena. Sweet dreams.

14. Las hojas de mi cuaderno están llenas de garabatos y notas.

15. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

16. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

17. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

18. Wala akong pakelam, basta nasa ref ng bahay ko akin!

19. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

20. The company suffered from the actions of a culprit who leaked confidential information.

21. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

22. The sun is setting in the sky.

23. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

24. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

25. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

26. He is painting a picture.

27. Ang pagpapalakas ng aking katawan sa pamamagitan ng ehersisyo ay nagbibigay sa akin ng isang matiwasay na pisikal na kondisyon.

28. The beach has a variety of water sports available, from surfing to kayaking.

29. El agua es un símbolo de pureza, vida y renovación.

30. The website's online store has a great selection of products at affordable prices.

31. My mom always bakes me a cake for my birthday.

32. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

33. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

34. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

35. Malaki at mabilis ang eroplano.

36. Bumili ako ng blusa sa Liberty Mall

37. The executive branch, represented by the President of the United States, is responsible for enforcing laws

38. Marurusing ngunit mapuputi.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

41. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

42. The damage done to the environment by human activity is immeasurable.

43. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

44. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

45. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

46. Kumaliwa ka papuntang Masaya Street.

47. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

48. Magaling na ang sugat ko sa ulo.

49. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

50. Ang kalayaan ay isa sa mga pinakamahalagang karapatan ng bawat tao.

Similar Words

content:content,

Recent Searches

contenthimutokmagsasamadalhannaglalambingonlybasketballlinggongskirtnapakatagalnanlalamigthoughtsunconstitutionalmagdamaganspaamongvariedadpinanoodlihimdoble-karanararamdamannatinagbinawianyeyunansoccertahananniyadivideskararatinghalamanbangipasokgayunpamanpiyanopinakamahalagangbuenainyoapatnapuaseankundidiseasesstaybutofireworkshetopansamantalaeffektivhalalanmalampasanbumangonestablishhastasinimulantinyexpresansanglumisankolehiyolastingtilibuwayahinarolledabalauugod-ugoditinanimdaansamunagmistulangnunostrategiesexperienceswriting,youtube,noongiigibnagandahananodennenakalipasreservesreaksiyongagawinnapakagandangapelyidographicmatesareadingitakpinatiraalokkinagagalakparaangpagkatenterayawmotionamericansiniyasatsusunodlandoitinatapatnakatagoiyaktungkolcommerceumigtadkagandahagadobonakatitigbuhaycouldmag-aaralmamarilnaghihiraphigalondonmakauuwitinanongsakristanmahahanaydiyandistancesligayasutilkampanastarredkagalakannapipilitanhimihiyawna-suwaymaintindihanpangungusapdogsikatkanangencompassesdekorasyonskyldesmananahialas-diyesnitongnaka-smirkso-callednaaksidentechoiinislubossumamasnakasalananbitaminamagturoomfattendeproductsmanuelfalllikodbigongedukasyonsisipainmagkaharapnaglalarosabadiniirogkulturpagkahapokakaibamaatimliligawanrenatoreboundmarangyangbihirabiensilyaharingnaiinitanpangambasumayawhinukayposterprobinsiyaiconanumaniwinasiwassirespecializadasperseverance,pantalonsakyanawarehinihilingwakasbloglovebalitatignanpabalang