Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. The invention of the telephone led to the creation of the first radio dramas and comedies

2. Wie geht es Ihnen? - How are you?

3. Sweet foods are often associated with desserts, such as cakes and pastries.

4. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

5. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

6. Huminga ka ng malalim at tayo'y lalarga na.

7. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

8. Esta comida está bien condimentada, tiene un buen nivel de picante.

9. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

10. Karaniwang mainit sa Pilipinas.

11. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

12. Les chimistes travaillent sur la composition et la structure de la matière.

13. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

14. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

15. He is typing on his computer.

16. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

17. Ang paglabas sa kalikasan at pagmamasid sa magandang tanawin ay nagpapalakas sa aking loob at nagbibigay ng isang matiwasay na kalagayan.

18. Nationalism can also lead to authoritarianism and repression of dissent.

19. En invierno, muchas personas disfrutan de deportes como el esquí y el snowboard.

20. Ngayon lamang ako nakakita ng dugo na kulay abo.

21. Siguro matutuwa na kayo niyan.

22. La película produjo una gran taquilla gracias a su reparto estelar.

23. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

24. Rawon adalah hidangan daging yang dimasak dengan bumbu rempah khas Jawa Timur yang berwarna hitam.

25. Ang poot ay maaaring maging mapaminsalang puwersa kapag hindi ito naayos nang maayos.

26. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

27. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

28. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

29. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa.

30. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

31. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

32. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

33. Elije el lugar adecuado para plantar tu maíz

34. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

35. Ang puting pusa ang nasa sala.

36. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

37. "Dogs never lie about love."

38. Malapit lang pala bahay niyo eh. akala ko naman malayo!

39. Binigyan ni Jose ng pera si Bob.

40. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

41. In this industry, singers who can't write their own songs are a dime a dozen.

42. There were a lot of options on the menu, making it hard to decide what to order.

43. Hudyat iyon ng pamamahinga.

44. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

45. All these years, I have been creating memories that will last a lifetime.

46. Nagalit ang diwata sa ginawa ng madamot na matanda.

47. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

48. Lumiwanag ang paligid dahil sa paputok.

49. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

50. Halos maghalinghing na siya sa sobrang pagod.

Similar Words

content:content,

Recent Searches

leadcontentshiftinteligentesevolvedfallwaithatesalapiprogrammingmakapilingknowledgeattackcontinueoraskategori,nag-away-awaygumagalaw-galawdogsnagtrabahonakakatawanagpapaigibpinagbigyanmakatatlosinasadyanapakaningningmagpalagonakauwititabrancher,magagamitinlovepakistanmusicvaliosamanaloibabawniyogvarietynapakapatiencetulangmatapanguboayokowatervalleymaestroaabotreviewersalagasnobmenosideasspecializedelectronictuwidimagingclientesflysofaboxcomputereipinabalotdifferentfrogaffectefficientilangpinakamahalagangpagkakapagsalitanagpapasasaikinasasabikmakikipag-duetonakikilalangpagkakayakappinakamagalingnagpakitanakakapamasyalnakakadalawnakabulagtangmurang-muramagpa-checkupsalu-saloaksiyonnalalabimakitanalalamannakalipasnagbiyayanananaginipnakaka-inmerlindaanibersaryomalezanalalaglagnakikiatungawmasayahinisulatpaki-drawingdahan-dahanmagsusunuranpinakamahabaculturalpaglalabadaenergy-coalmahiwagangnangangalitfilipinamaghahatidambisyosanglalakipaghaharutannakikitanghitaunattendedpagkasabinapagtantoexhaustionatensyongtungkodpananglawnag-emailumagawtumikiminiindamagtakakontratasaan-saanuulamincorporationmamalassabihinnaghihirapadgangsundalopagkuwannapalitangtv-showslumayopagsahodpagdudugonalalabingpamasahetinaymaghihintaymagkanodiyaryohistorydadalawnamumulanakahaininagawmahirapmagdamagumiisodpabulongmagkabilangbihirangtherapeuticspinabulaankangitannaiiritangipinauutangngitimahalsisikatgarbansosnabuhaycruzkilaynakabaonnauntogsunud-sunodpesoawitanpumikitdecreasedrewardinggatashirammahahawasubject,nanigaspesosendvidereconclusion,niyowakasmaskarauniversitiesnagsimulabagamathawlalunasmisyunerongsisentaminahanmalawak