Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

2. Nagpabakuna kana ba?

3. Nagtaka ako kung bakit hindi pumasok ang guro sa klase ngayon.

4. Les algorithmes d'intelligence artificielle peuvent apprendre à partir de données et améliorer leur performance au fil du temps.

5. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

6. Mga ganid sa kapangyarihan ang ilan sa mga pulitiko.

7. Sweetness can be balanced with other flavors to create a harmonious taste experience.

8. The concert raised funds for charitable causes, including education and healthcare.

9. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

10. Oh gosh, you're such an ambisyosang frog!

11. Nasira ang kanyang sasakyan dahil sa isang aksidente sa kalsada.

12. Sa hatinggabi, naiiba ang itsura ng mga lugar kaysa sa araw.

13. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

14. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

15. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

16. The love that a mother has for her child is immeasurable.

17. There were a lot of toys scattered around the room.

18. Hindi madaling mahuli ang mailap na pag-asa.

19. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

20. Uuwi na ako, bulong niya sa sarili.

21. Scissors are a cutting tool with two blades joined together at a pivot point.

22. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

23. Maruming babae ang kanyang ina.

24. Sa simoy ng hangin, maaamoy ang mabangong amoy ng damo sa bukid.

25. Bakit ba? Hinde ba ko pwedeng magsungit?

26. Argh. Parang batang bading naman eh. Anubayan.

27. Rebuilding trust and repairing a relationship after cheating can be a difficult and lengthy process that requires communication, commitment, and forgiveness from both partners.

28. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

29. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

30. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

31. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

32. Sa tingin ko ay hindi ito magiging epektibo kaya ako ay tumututol sa kanilang desisyon.

33. Los motores de búsqueda nos permiten encontrar información específica en línea.

34. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

37. There were a lot of flowers in the garden, creating a beautiful display of colors.

38. Hindi mo alam ang sagot sa tanong? Kung gayon, dapat kang mag-aral pa.

39. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

40. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

41. Sino yung naghatid sayo? biglang tanong niya.

42. She's always gossiping, so take what she says with a grain of salt.

43. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

44. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

45. A couple of cups of coffee in the morning help me start my day.

46. Di ka galit? malambing na sabi ko.

47. Eating healthy is an important way to take care of your body and improve your quality of life.

48. The police were trying to determine the culprit behind the burglary.

49. The art class teaches a variety of techniques, from drawing to painting.

50. Más vale prevenir que lamentar.

Similar Words

content:content,

Recent Searches

darkcontentelectronicviewspollutionipipilitibinubulongitinalagangideassaringmedya-agwapotaenastatusblusaideyaumiinomtondoglobalisasyoncarriesisinumpamatiyakpinapakiramdamankapainkinantasabihingbaulxixtsakaakmajeromegrabeitongcrazypointremoterepresentativenapakalakasmakikipag-duetomamulotsizerewardingkabuntisanpawiinkananrebolusyontanodsilbingultimatelyespigasamparoseriouscenterspare00amusolutuinpatrickamazonmediumonlyskillscalequalitymotionplagaspusainalagaankirottugonfe-facebooksabogself-defenseinintaytvslaylayditotekstperangteachsamupasansinongtumalimmorenaipapaputolaabotvalleypagkainhiningigrammarfauxpanoalaalaumiyakarbularyolaruinnapapahintolumamangsinasabipansamantalavitaminskillsmaskinerpagiisipcynthialabispaaralanbinge-watchingredescommissionsystematiskbinigaybumahasinunodfiancebagyoinantokumanohumanospumuntadyanadditionjackzgabefakeexamlargerpulang-pulamusiciannapatawagnaglalakadvideos,gratificante,nakakatulongnag-aagawannapakagagandamagpapagupitnalalabidisenyongpapanhikkalayaanmagkaibaewanstrategiesnapakalusogkusinerobeautysunud-sunuranpresence,ukol-kaypagpapakalatpagkakapagsalitapaulit-ulitmaghihintaytilgangprincipalesmaabutansay,nakahainaga-agamapuputiumuuwikumapitkaniyananigasmauntogniyanbutterflyumulanairplanesnasuklamawarddiapernilapitantiyanmaatimidiomaannikahetobuenaparkemalamangrenatonuhfitpublicationkatagabathalahatinglimitlorenaipinatwinklenuclearngpuntamabutingdibisyonentrynakayukodiwatang