Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Emphasis can be used to create a memorable and impactful message.

2. The acquired assets will improve the company's financial performance.

3. They go to the gym every evening.

4. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

5. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

6. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

7. She had a weakened immune system and was more susceptible to pneumonia.

8. Bagamat naghihirap ay alaga siya ng ama't ina sa masasarap na pagkain.

9. Cuídate mucho de esas personas, no siempre son lo que parecen.

10. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

11. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

12. He is running in the park.

13. It's wise to compare different credit card options before choosing one.

14. The festival showcases a variety of performers, from musicians to dancers.

15. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

16. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

17. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

18. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

19. Aus den Augen, aus dem Sinn.

20. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

21. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

22. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

23. Sadyang mapagkumbaba siya kahit na siya ay mayaman.

24. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

25. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

26. Binigyang diin niya ang pagpapasakit ng Anak ng Diyos.

27. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

28. I am planning my vacation.

29. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

30. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

31. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

32. Wag kang mag-alala.

33. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

34. Naglaro sina Paul ng basketball.

35. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

36. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

37. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

38. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

39. We have been waiting for the train for an hour.

40. Omelettes are a popular choice for those following a low-carb or high-protein diet.

41. Alam ko na hindi maganda ang agam-agam ko, kaya kailangan kong magsumikap upang malunasan ito.

42. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

43. Dahil sa globalisasyon, lubos na umangat ang teknolohiya ng maraming bansa.

44. Ha? Ano yung last na sinabi mo? May binulong ka eh.

45. Magkano po sa inyo ang yelo?

46. Ang pag-alala sa mga bayani ay isa sa mga paraan upang maipakita ang pagpapahalaga sa kanilang sakripisyo at pagmamahal sa bayan.

47. Hindi ba nagdaramdam ang nanay at tatay mo?

48. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

49. Hang in there and don't lose hope - things will turn around soon.

50. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

Similar Words

content:content,

Recent Searches

leftjohnenvironmentrepresentedcontentroquesteermotionniceonlytaopakisabischoolsnagliwanagperaoutlinekaninumanmisteryokayaganitoedsadisyemprebankpinalayaspapelkelanpatiproblemaayawubodordersaidiphonedamdaminnakakunot-noonglangkayeducationaalisdetboxingkwartosilbingnangingilidkumikiloscramesimbahanumulanmarahasdegreesnagtapospetsasinipangmaaliwalaspananakitsiyampilipinostandmanghulipagluluksanakaliliyongpinagsikapanikinagagalakreaksiyonpinahalatamanggagalingpagngitikwenta-kwentat-shirtpinagpatuloynagtagisansasayawinpagkaimpaktoginugunitamarketplacesnangampanyailanritohojasbabasahinnag-iisipjannatinignagbagoaanhindumagundongminu-minutobefolkningen,uusapannageespadahanmakatatlomagsusunurankagandahannagpabayadgumawanakakainkamiaskinumutannangyaripagtataastatagalromanticismomagtataasmahiyaforskel,kapasyahanmagpahingahanapbuhaykapitbahaynakabluemakawalaonline,marketingsinisiramasaganangyouthnapuyatuulaminpeksmanmaibibigaynagagamitsarilipantalongpwedenggagamithinalungkattiemposbayadbangkangtagpiangtiyakkaratulangtelecomunicacionestig-bebeinte3hrsnasirapagraranasunospesospagsidlanpayongmandirigmangampliasakopkirbytiniklingtagumpaymasungitbooksexpeditedestilosiyakanongadmiredlittlepinoyligaligkamotetengapalibhasanochesubalitmariangwashingtonreguleringsaybotantekalakingkatagalancolorkaugnayanbalotknightriyanpinagnararapatpinaladerapboyetibongeneipaliwanagburgerdetteeffortspariparocelularesnobledalawagagambasedentaryexpectationsbulacomedrewgenerationerfuncionesginisingellachess