Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Nakakalungkot isipin na wala na si Fr. Manoling Francisco, SJ, isa sa mga nagtatag ng Bukas Palad.

2. She has started a new job.

3. Masayang-masaya siguro ang lola mo, ano?

4. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

5. A successful father-child relationship often requires communication, patience, and understanding.

6. Ibinigay ng titser ang libro sa estudyante.

7. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

8. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

9. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

10. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

11. ¿Te gusta el sabor picante del jengibre?

12. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

13. Mahirap bilangin ang mga bituin sa langit.

14. Ang kasal ay nagbibigay ng mga ala-ala at emosyon na hindi malilimutan ng mga taong kasama sa okasyon.

15. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

16. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

17. Wala dito ang kapatid kong lalaki.

18. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

19. Umabot umano sa isang milyon ang mga dumalo sa pista ng bayan.

20. Saglit lang lang naging kami. Sabi niya sa akin..

21. Nagbalik siya sa batalan.

22. Mathematics can be used to optimize processes and improve efficiency.

23. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

24. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

25. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

26. Kung may tiyaga, may nilaga.

27. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

28. Sang-ayon ako na kailangan nating magkaroon ng malakas na liderato upang umunlad ang ating bansa.

29. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

30. Narinig ko ang hinagpis ng mga magsasaka dahil sa mababang presyo ng kanilang ani.

31. The dedication of mentors and role models can positively influence and shape the lives of others.

32. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

33. Ikinakagalit ko ang mga sakim na minahan.

34. Nakita niya ang nagbabagang bulkan mula sa malayo, nagpapakita ng lakas ng kalikasan.

35. Makisuyo po!

36. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

37. Anong kubyertos ang hiningi ni Maria?

38. Makikitulog ka ulit? tanong ko.

39. Iiwan lang kita pag sinabi mong iwanan na kita..

40. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

41. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

42. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

43. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

44. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

45. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

46. Gusto ko sanang bumili ng bahay.

47. Kumain ako sa kapeterya kaninang tanghali.

48. Si Anna ay maganda.

49. Nag shopping kahapon si Tita sa SM.

50. Helte findes i alle samfund.

Similar Words

content:content,

Recent Searches

contenteachfaceimprovelcdclearanilalanangagsipagkantahangayunpamancourtgovernmentdeliciosakubyertosmagsi-skiingnakuhasumapitwifibumangonmariloueleksyondisciplinlittleibilibahay-bahayanrawbibisitapagpapautangpinagalitantobaccopinagpatuloybilingnamuhaysaan-saannapakatagalnagtitindanakapagreklamovirksomheder,makikikainmanghikayatnagreklamocultivamagbabagsikkolehiyovidenskabkumalmanagdadasaltaga-hiroshimapandidirimarketing:dadalawbutikituktoktemperaturaisinagotlungsodgawainpakiramdamkisapmatakulturpinangalananwalang-tiyakeksport,papayagatasgawaingalagangbilibidiniangatitinaassigurohinugotgawingisinarasellingimbesrolandguidancenapilitangbuwayaparangpagtangiskalabantapatnasaduonpanayhiningiisinalangwasakjenacarlokarangalanupuanexpresanmaisippa-dayagonalcoinbasezoomsteveginisingbrindarsystematisksorrypagapangngunitborndaddynilutopollutionmanuelmapakalierrors,convertingmaratingservicessetsmatandaalas-diyesbunganapagtantonakitamadamipagpapakalatyumabonglibrenakabiladkaaya-ayangdevelopiintayinawarenagpagupitmapag-asangayudatumakasnapapikitdaramdaminmalakasinventionhonself-publishing,pagkagisingisinusuotkamikainanwastetinikmapayapacapitaloneroughumanooftentelevisedupworkfuncionarchambersmainitheibarbumabadidkapaghangaringfueasimpiecesultimatelylagiasatonightmaaridietsourcebalangrizaltv-showsyakapinnapapansinpangungusaphalu-halonanlalamignabighanimahuhusaykanikanilangsinacalidadbisikletangipingnapabayaningminahankinatatalungkuangnagtutulunganpagbabagong-anyokusinapondogurotahananpagtiisan