Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "live"

1. All these years, I have been striving to live a life of purpose and meaning.

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

4. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

5. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

8. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

9. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

10. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

13. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

14. Seeing a favorite band perform live can create a sense of euphoria and excitement.

15. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

16. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

17. The king's subjects are the people who live in his kingdom and are under his rule.

18. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

19. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

2. Hinila niya ako papalapit sa kanya.

3. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

4. Einstein was a pacifist and spoke out against war and violence throughout his life.

5. Lazada is an e-commerce platform that operates in Southeast Asia.

6. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

7. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

8. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

9. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

10. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

11. It's important to maintain a good credit score for future financial opportunities.

12. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

13. Isa sa nasa pagamutan na iyon si Bok

14. Ano pa ho ang kailangan kong gawin?

15. Bilang paglilinaw, ang meeting ay hindi kanselado, kundi inilipat lang sa ibang petsa.

16. Wag ka na lang pumunta sa Palawan. aniya.

17. Esta salsa es dulce y picante al mismo tiempo.

18. Research and analysis are important factors to consider when making investment decisions.

19. May kahilingan ka ba?

20. Ako si Rodona ang diwata ng budok na ito.

21. Sinabi niya sa dakong huli na gusto na niyang mag-resign sa trabaho niya.

22. Galing sa brainly ang isinagot ko sa asignatura.

23. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

24. Palibhasa ay may kakaibang pagtingin sa mga bagay dahil sa kanyang malawak na kaalaman at pag-unawa.

25. Maliksi siyang lumapit at binatak ang bata sa liig.

26. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

27. La obra del artista produjo reacciones diversas entre los críticos.

28. Dogs are often referred to as "man's best friend".

29. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

30. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

31. We have cleaned the house.

32. El powerbank utiliza una batería recargable para almacenar energía.

33. Masyado akong matalino para kay Kenji.

34. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

35. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

36. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

37. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

38. Umiiyak ang langit sapagkat tuyo na ang lupa.

39. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

40. Mag-ingat sa aso.

41. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

42. Nagwalis ang kababaihan.

43. Mathematics can be both challenging and rewarding to learn and apply.

44.

45. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

46. La tos seca es una tos que no produce esputo o flema.

47. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

48. La película produjo una gran taquilla gracias a su reparto estelar.

49. Ang mga tradisyunal na parada ay isang kakaibang aspeto ng Chinese New Year.

50. The management of money is an important skill that can impact a person's financial well-being.

Similar Words

liveserhvervslivet

Recent Searches

liveisinaboyhihigitnapaluhacultureproporcionarjudicialnalamantagtuyotreaksiyonnagagandahankasingchefbandaexpertiseincludenag-aalalangsurgeryenergy-coalmanakbobintananakilalahulusuzettegulateclipxenagpapaigibcomputere,styrercubicledilawpunotemperaturakinatatalungkuangpagkakatayobusogallenakasahodmakaiponnakaangatumuuwikagandahagkarangalansumisilipbuhaypoongclienteanihinfeelpiyanopagkagisinghumihinginangyariviewsmagpa-pictureisinusuothinogknownmeandaramdaminwaysnabiawangpakilutonagbagotumamaihahatidtatlovaliosahapdiproperlystatebroadcastingninumansegundoentervisualipipilitedit:tawanannakakaenmaligayacultivogamesrelohumiganaawaricomagkasintahankasayawsakintumikimorastanghalipaparusahanamangpulaulannakatiraconnag-aagawankamalayancameramagpakasalpinagmamasdansumusunodtinikniyansundhedspleje,nakakatandapagtatakaneartransport,christmaskommunikererpromotekagipitannapadpadmaayosrawuwakbentahanmaariumabogipinikitmatipunoaaisshlabanannagsuothumabolinvesting:nicoblusangkinalalagyanmadadalanakauslingnagbibigayaninvitationpasanbeintenakumbinsiopgaver,yamantherapeuticsconclusion,tsismosamasayahintaposalas-diyesnapakagagandanilalangdividedatensyonpagkainisdraybereconomickinagalitangoodmerlindanahawakansongscrucialgumagamithinipan-hipannaritomahawaanuriplaysngitinagliniskapwaresponsibleanibersaryopinamalagiforståbalediktoryanemphasizedlalakesparkconditioningmagbubungahehetumahanlamangipalinislimangpootbusilakmalagootrasskyldes,bukodrosenakanationalbabycultivarkorearememberedsamfundlaryngitis