Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "live"

1. All these years, I have been striving to live a life of purpose and meaning.

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

4. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

5. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

8. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

9. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

10. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

13. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

14. Seeing a favorite band perform live can create a sense of euphoria and excitement.

15. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

16. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

17. The king's subjects are the people who live in his kingdom and are under his rule.

18. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

19. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Pero kahit marami ang sumunod sa itinuturo ng paring Espanyol ay may isang barangay na bulag pa ring sumasamba sa mga anito.

2. Sinadyang hindi magsuot ng mahal na damit si Juan sa kanyang pamamamanhikan upang magkaruon ng mas malamig na pakiramdam.

3. Mura lang ang mga damit sa Greenhills.

4. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

5. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

6. Ang maliit na aso ay hinahabol ang anino ng saranggola.

7. Bumilis bigla yung tibok ng puso ko.

8. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

9. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

10. Magpapabakuna ako bukas.

11. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

12. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

13. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

14. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

15. Magdoorbell ka na.

16. La brisa movía las hojas de los árboles en el parque.

17. Ituturo ni Clara ang tiya niya.

18. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

19. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

20. Einstein's brain was preserved for scientific study after his death in 1955.

21. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

22. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

23. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

24. Dalawampu't walong taong gulang si Paula.

25. They admired the beautiful sunset from the beach.

26. Ang mga palaisipan ay hindi lamang nagbibigay ng hamon sa ating kaisipan, kundi nagbibigay rin ng mga oportunidad para sa pagpapalawak ng kaalaman.

27. Bukas na pala ang araw ng kalayaan.

28. El error en la presentación está llamando la atención del público.

29. Ano ang alagang hayop ng kapatid mo?

30. Masaya pa kami.. Masayang masaya.

31.

32. Puwede siyang uminom ng juice.

33. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

34. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

35. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

36. La realidad es que las cosas no siempre salen como uno espera.

37. Dapat kong bilhan ng regalo si Maria.

38. Kukuha na ako ng lisensya upang makapagmaneho na ako.

39. Muchas personas prefieren pasar el Día de San Valentín en casa, disfrutando de una cena romántica con su pareja.

40. She is not playing with her pet dog at the moment.

41. When in Rome, do as the Romans do.

42. Nació en Caprese, Italia, en 1475.

43. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

44. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

45. Sana makatulong ang na-fund raise natin.

46. Marami ang nag-aadmire sa talambuhay ni Gabriela Silang bilang isang babaeng mandirigma at lider ng rebolusyon.

47. Internal Audit po. simpleng sagot ko.

48. Nagustuhan kita nang sobra, kaya sana pwede ba kita makilala?

49. Ang bilis nya natapos maligo.

50. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

Similar Words

liveserhvervslivet

Recent Searches

atetwinkleliveharikararatingdiniteleponopag-aaralbituinclockbehaviordumaramibetweenallowsmonitoruniqueipinalutoneverreleasedmerepointmagkikitanapakamisteryosoanibersaryopoliticalkinamumuhiannakakapamasyalpag-aanikinagalitanmakahirampresidentialkaloobanginspirasyonadverselymahawaancancernegosyanteglobalisasyonmayamayasasakyannandayapioneertravelkumainpagbatiproductividadmagsusuotpansamantalakahulugankagipitanpagkainisencuestasnakatindigmagbalikpagbabayadnasasalinankinalilibinganmalulungkottahananpagsagotincluirnakataaspakakasalanngitimaanghangdistanciaitemskasoindustriyaorkidyaspagdiriwangumangatnahantadtanawhinamakvaledictorianturismomaintindihangaanoiconshimayinaregladoatensyonsenatecontesttapatinternadalandancrazyartskabibijeromenakakadalawmakapangyarihanggobernadorkinakabahanpinagbigyankusinanagmungkahimakikiraanplagasmensajeskare-karenungbisitanegro-slavesemocionalpaglalabapamilyayumuyukotv-showsdaymahabangskyldes,nakatitigexittumaposisusuotmabigyannaglulusakdespuesbaguiopresidentelipatilagaysurroundingstaga-hiroshimapootwikadikyamtararestawanschoolsdagadoingtruesumugodmagpa-ospitaltinapaybayabasafterpakikipaglabankalayaanestudyantepunongkahoynagtitiisnagtatakbonagmakaawamagbabakasyontumawagmusicianfotosmagpapagupitlumakasmakapagsabilumamangnapuyatfulfillmentnilangpinagsanglaaninspirebayanimalungkotkulisaplumbaymagingiigibsocialeenerotrafficlaybrarithankriyandirectdingctilesrenaiayonhusoiguhitpatiipaliwanagmapayapamagpapaligoyligoymestbangallottedtwo-partymatanglayasfuepossiblenakakitananggigimalmaleconomicusuarioprofessionalnalasingeasiergabe