Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "live"

1. All these years, I have been striving to live a life of purpose and meaning.

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

4. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

5. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

6. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

7. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

8. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

9. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

10. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

11. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

12. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

13. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

14. Seeing a favorite band perform live can create a sense of euphoria and excitement.

15. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

16. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

17. The king's subjects are the people who live in his kingdom and are under his rule.

18. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

19. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. El lienzo es la superficie más común utilizada para la pintura.

2. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

3. Nakaka-bwisit talaga ang nangyari kanina.

4. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

5. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

6. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

7. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

8. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

9. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

10. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

11. Les programmes d'études sont élaborés pour fournir une éducation complète.

12. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

13. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

14. A couple of minutes were left before the deadline to submit the report.

15. When he nothing shines upon

16. Hatinggabi na nang iwasiwas na muli ng butihing Ada ang kaniyang makinang na pananglaw.

17. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

18. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

19. Paparami iyon at pumapaligid sa kanya.

20. The scientific method involves forming hypotheses and testing them through experiments.

21.

22. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

23. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

24. Guarda las semillas para plantar el próximo año

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

27. She loved to travel, and therefore spent most of her savings on trips.

28. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

29. Nahawakan ko ang katawan ko, Umabot ba kami hanggang dun?

30. This could be physical products that you source and ship yourself, or digital products like e-books or courses

31. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

32. Tienes que tener paciencia para lograr buenos resultados.

33. Kalimutan lang muna.

34. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

35. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

36. It's raining cats and dogs

37. Masasaktan ka kung malalim na babasagin niya ang kaibuturan ng iyong pagkatao.

38. Women have a higher life expectancy compared to men, on average.

39. Hinanap niya lahat ng kabarkada niya sa sugal at sinisi sa nangyari sa kanya.

40. Napagkasunduan ng grupo na i-expel ang miyembro na na-suway sa kanilang code of conduct.

41. Naghanap siya gabi't araw.

42. Min erfaring inden for dette område har været meget givende.

43. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

44. She has run a marathon.

45. Di na natuto.

46. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

47. El algodón es un cultivo importante en muchos países africanos.

48. Ako'y lumilipad at nasa alapaap na.

49. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

50. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

Similar Words

liveserhvervslivet

Recent Searches

stonehamlivetheymuchosluissequeinteractdoingdatabathalaimpactedimprovedplatformmitigatenagtatanimpatakbongnagsipagtagonatatanawmedianagkasakitwordfundrisemagtatagalteknolohiyanag-iinomlibopangungusapnai-dialtamarawmaskarapasigawpangyayaripasaherobalangmangunconventionalpaketelaruanbroadcastlegislativepepesaan-saanintensidadtumalonkilongsumusulatmagtigilpilipinasadgangmateryaleskinalakihannagsmilehealthierreserbasyoneskuwelahannagpakitapare-parehomakakatakasmakauuwikumukuhatatlumpungpinakamahabamagbabagsikerhvervslivetnagpalalimluluwasnagtungonapapatungonagtuturonananaghilipinagalitannapapalibutanpangambasakanabighanikumidlatphilanthropygandahanh-hoynapakamottag-arawkabundukaniintayinentranceinaabutannakasakittumalimhayaanricatumakastaga-hiroshimamedikalproductividadpangangatawanpinasalamatanmovieisipnahigitanpaidsuzettediinnamumulapabulongsagutinisinuotjingjingpuntahankanginanagwalisvictoriagalaantalinoginawangtungoculturesbinitiwaneksempelseryosongkangitantinuturokutsaritanginiangatretiraribilikayoturonlakadmabibinginuevogatasroofstockexigenteiginawaddreamssikippagkaingrestawranangkopmaghintayalagaanilasumasaliwasawacompletamenteespigasinulitincidenceyaridagatvivamissionchickenpoxkalongiyaknamatokyomatipunonatanggapbernardobinigayprimermerrymaarihusobranchmahigitclasesstaplechildrenindustrypangitcuentansinonglatestlarrycallerformashumanosaftermesangmasdanprocesoparagraphsmallenglishpupuntamacadamiainuminnilutoleepaabilerconcernsbelievedcompartencoachinginisnagalitreportiniling