Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "namilipit"

1. Namilipit ito sa sakit.

Random Sentences

1. Ang abilidad na makisama sa iba't ibang tao ay isang mahalagang aspeto ng liderato.

2. At sa tuwing tataas, hahanapin ako ng tingin sa baba at malungkot nangingitian.

3. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

4. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

5. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

6. Hay muchas hojas en el jardín después de la tormenta.

7. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

8. Dogs can provide emotional support and comfort to people with mental health conditions.

9. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

10. The movie was rated R, and therefore she wasn't allowed to watch it.

11. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

12. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

13. Matagal ang pagluluto ng kare-kare.

14. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

15. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

16. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

17. Bahay ho na may dalawang palapag.

18. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

19. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

20. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

21. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

22. Wala dito ang kapatid kong lalaki.

23. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

26. Oh sige na nga sabi mo eh. hehe.

27. Saan pupunta si Trina sa Oktubre?

28. Don't give up - just hang in there a little longer.

29. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

30. Tignan nyo. ngumingisi! May balak yan! Psh.

31. Halos hindi niya narinig ang halingling ni Ogor.

32. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

33. Cryptocurrency is often subject to hacking and cyber attacks.

34. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

35. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

36. Kabilang na roon sina Lala, Dada at Sasa.

37. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

38. In the early days, telephones were connected to a central switchboard, which connected calls manually

39. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

40. Me duele todo el cuerpo. (My whole body hurts.)

41. Ngunit naglahong parang bula si Pinang.

42. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

43. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

44. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

45. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

46. Cancer can impact not only the individual but also their families and caregivers.

47. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

48. Nakatira si Nerissa sa Long Island.

49. Pero gusto ko nang umuwi at magpahinga.

50. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

Recent Searches

namilipitfakepinagkasundoahassusibateryaparurusahankindsnapapatinginartealmacenarsapotnapilitangprosesohastasamakatwidhugisparkingnaggalamedyosumasakitfarmpasigawrevolutionizedmalihisbukasshinesmaidpaaralannagtatanongaywanrabehydeltonbatipanaykablanshopeeboracaycalciumpalagihehereboundhojasoperateconventionaldelenatingalabranchesdragonreservationbansatanimbokavailableso-calledkaringkayaactualidadtelevisedmetodederbroadaddlockdownibabaetostandcomunestargetmaisgenerationerwealthipinikitkapilingparingpagpapasakithappyproducerercuredninumanpagkasabiplatformdiwatatuluyanhiliglagaslasfollowing,investingsino-sinosinomanakboanghelkaarawantoybathalaenerginagpabakunanakatitigmaalwanganongilagaybilanggobooksbutimatikmanpulitikogigisingtengaandoymariediaperginugunitanaglalakadsundhedspleje,gayunpamannag-iyakankumembut-kembottinaasanunahinnapapasayainirapanmakakawawapanghabambuhaypagtiisanaanhinpagpapakilalanalalaglagvideos,nakagalawnagmungkahiginamottatayotatagalunattendedbeautypronounh-hoyutak-biyapinagkiskisiintayinnakayukotungawkulungannangyarimahiwagamedikalhalu-halonapapansinadgangpioneersharmainemagdoorbellinvestgovernmentipinauutangnangampanyamatayogkabibirektangguloipinatawagisinuotpamagattungkodpagkaawanag-emailmusicalesnakataasintensidadnanunuribintanapasasalamatpapalapittagpiangtrentamahalculturestandangnakabluekumananmasaganangpakiramdamnagdalaarturoipinansasahoggrocerypangalananhelenanabigaynaglabachristmashinalungkatnaawatagumpayfollowingtalagangkasalsinisilupainbumangon