Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "de-lata"

1. Halos de-lata na lang ang lagi nitong inuulam.

Random Sentences

1. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

2. Football coaches develop game plans and strategies to help their team succeed.

3. Hindi madaling mahuli ang mailap na pag-asa.

4. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

5. Ang mga pangarap ay nagbibigay sa atin ng direksyon upang magkaroon ng layunin sa buhay.

6. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

7. Money can be saved and invested to achieve financial goals and build wealth.

8. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

9. Paano ho pumunta sa Manila Hotel?

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

12. Me duele la espalda. (My back hurts.)

13. The athlete completed a series of intense workouts to prepare for the competition.

14. Kapag wala akong iniisip na problema, ako'y nakakaranas ng isang matiwasay na pagkakasundo sa aking sarili.

15. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

16. Fathers can also play an important role in teaching life skills and values to their children.

17. Some dog breeds are better suited for certain lifestyles and living environments.

18.

19. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

20. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

21. It's complicated. sagot niya.

22. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

23. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

24. Children's safety scissors have rounded tips to prevent accidental injuries.

25. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

26. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

27. Oh gosh. Inintay pa sya ng prince, what does it mean?

28. Bersatu kita teguh, bercerai kita runtuh.

29. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

30. The exam is going well, and so far so good.

31. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

32. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

33. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

34. Erfaring har lært mig, at kommunikation er nøglen til en vellykket virksomhed.

35. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

36. Ikaw ang magnanakaw! Amin yan! Nasa ref ng bahay ko!

37. She spends hours scrolling through TikTok, watching funny videos and dance routines.

38. El internet ha hecho posible el trabajo remoto y la educación a distancia.

39. Yakapin mo ako, habang atin ang gabi.

40. They offer interest-free credit for the first six months.

41. Magaling na ang sugat ko sa ulo.

42. Wolverine has retractable adamantium claws and a regenerative healing factor.

43. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

44. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

45. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

46. Ang ganda naman ng bago mong cellphone.

47. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

48. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

49. A wife can be a source of emotional and physical intimacy for her husband.

50. La realidad es que a veces no podemos controlar lo que sucede.

Recent Searches

de-latakailanmanbandalagunabuntiskutodkasuutanbagalsalbahebumuhosgagambabinibiliangelafederalprosesolintamapahamaktshirttrensinimulanbinulongmalikotnaiinitanaminsikolandkasakit1940espigaspopcornpetsangiguhitawahojaswalngpangitharaptapat1920scinePagkamulatopisinakunebaulnyelawsbinigayfeltsinipangsubjectcitizenspiercaregearminutoadventnag-iisalaylaytandadahonmacadamiameandedication,cebudaanbrucefeelsaringburdengonekinasuklamanventabringingcakenasundodigitalcesmobilepinilingbinabamainitdevicesoverviewmakilinguminomitemsprogramsstringayanremoterepresentativeherenegativehulinglibagissuesestablisheddalawamakatarungangtingindeterminasyonpagamutanparinalalaglagkitangkanilacongratssumusulatmagdalaasalkaraokemagbubukidsumasayawnatutulogsinumanmagsabimadamotmahusaycramekumitanapakahusayhiganakaraangirltinungonapakahabanagwagituladmerchandiseyumaoinabutaniwanantatanggapingiraypangkatmag-isanaturalcarbonviolencetuwingvelstanddalawulamsusunodkapamilyaprivateandynagbabakasyonpinagtagponagtatakbobarung-barongmaipantawid-gutomlumiwanagmakahiramtinaasankagalakannakalagaynakapangasawakayonakapasoksunud-sunurannagkalapitgandahanpamamasyalmagsusunurannapakagagandaunti-untihoneymoonkayabanganarbularyoabut-abotcorporationhumalonakikitanghimihiyawsinasabipinangalanangpahabolnaiiritangtandangsukatinpinipilitipinatawagmaabutanmatutongsabongpasahekinakainmbricosfollowingisinaramangingisdangpasasalamatlalakadmasayadoslugawunconventionalninaturon