Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "subject"

1. Cryptocurrency is often subject to hacking and cyber attacks.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

4. Mathematics is an essential subject for understanding and solving problems in many fields.

5. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

6. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

7. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

8. The professor delivered a series of lectures on the subject of neuroscience.

9. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

10. Women have been subject to violence and abuse, including domestic violence and sexual assault.

Random Sentences

1. Lungkut na lungkot ang buto sapagkat madilim na madilim sa loob ng kasoy.

2. Claro que te apoyo en tu decisión, confío en ti.

3. The computer works perfectly.

4. Higupin ng halaman ang tubig mula sa lupa.

5. Madaming squatter sa maynila.

6. Wala naman sa palagay ko.

7. Don't underestimate someone because of their background - you can't judge a book by its cover.

8. Kung minsan, akala ng mga tao, masungit siya.

9. Nag-aaral siya sa Osaka University.

10. Sa bawat bagong taon, may ritwal silang ginagawa upang magdala ng suwerte at kasaganaan sa buong pamilya.

11. He forgot his wallet at home and therefore couldn't buy lunch.

12. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

13. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

14. Baka naman nag message na sayo, hinde mo lang alam..

15. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

16. Exercise can be tough, but remember: no pain, no gain.

17. They travel to different countries for vacation.

18. Hindi umimik si Lory sa mga tanong ni Chad.

19. Dumating ang pangulo sa pagtitipon.

20. Aling telebisyon ang nasa kusina?

21. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

22. There are a lot of opportunities to learn and grow in life.

23. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

24. He has been working on the computer for hours.

25. Ang ganda naman ng bago mong phone.

26. The stock market gained momentum after the announcement of the new product.

27. Dahil sa kakulangan ng kalinisan, naglipana ang mga daga sa tindahan.

28. Da Vinci tenía una gran curiosidad por la naturaleza y la ciencia.

29. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

30. Las hojas de los árboles proporcionan sombra y protección contra el sol.

31. Ang tulang ito ay may petsang 11 Hulyo 1973.

32. He's always telling tall tales, so take his stories with a grain of salt.

33. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

34. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

35. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

38. Nami-miss ko na ang Pilipinas.

39. El uso de las redes sociales está en constante aumento.

40. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

41. Ang aking mga kaulayaw sa simbahan ay naging mahalagang bahagi ng aking buhay.

42. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

43. Ayaw mo akong makasama ng matagal?

44. This has led to increased trade and commerce, as well as greater mobility for individuals

45. Es importante evitar rascarse o manipular las heridas para facilitar su cicatrización.

46. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

47. Bakit ho, saan ninyo ko dadalhin?

48. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

49. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

50. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

Similar Words

subject,

Recent Searches

subjectnausalconsideredhomeworkauditmuliphysicaldesdecebudevelopedreservationtipidhasbadetovasquespartnerofferheifuncionesmainstreameveryipagtimplafredconditioningfiguremind:viewsdevelopmentefficientbituinvisualuniqueactorberkeleywhykayang-kayangmapangasawangitipedenakakatabanagpabayadginhawapaciencianakakaintig-bebeintepatawarinnovemberhumihingitasaejecutannakakatandapakilutokinainbilugangwarieffort,nogensindechoiceexcusefatalchessinasikasopanatagnakakaanimmagsabiindustryisinalaysaynewspapersmanlatestlikodabshalagaboksingmotionjosieproveryanvillagetsismosamakakabaliknagbibigayankabighanabigayantesagam-agamkarapatannilulonsasayawincryptocurrencyhallfurkarnabalagospreviouslyhimkarangalanpupuntahanmalilimutanbagorobertperfectsalitanghatinggabimatandang-matandacomputerbahagihimutokgabingnunonakitulogjaceallowedalas-dospagdudugokukuhanagtutulungankalalakihannagreklamopagtutolkalabawgustongcallerginaganoontayosakaymatipunonakacarlomaarilamanmakatarungangomeletteinsteadsatisfactionmagpa-ospitalpagkakayakaphandaannagkasakitawtoritadongpaglalayagginagawahousetelebisyonmalakasmakilalalumusobsamantalangjagiyahelenatulalabuwanbangpostcardtools,kasicuandocontrolledngingisi-ngisingpinuntahannalakitangekskondisyonmatatagnakalocklot,paakyatmaranasankaninabibilinilapitantsinelasgananghanginmaistorbonaglabanandahongrocerypinakamalapitmurangeleksyonnamamayatkisapmataincludingoutlineboholmembersmejonatandaanpopularizemartesfuelaccederconectadosiboninvestyumaonawalanghumanos