Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "subject"

1. Cryptocurrency is often subject to hacking and cyber attacks.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

4. Mathematics is an essential subject for understanding and solving problems in many fields.

5. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

6. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

7. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

8. The professor delivered a series of lectures on the subject of neuroscience.

9. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

10. Women have been subject to violence and abuse, including domestic violence and sexual assault.

Random Sentences

1. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

2. Ang kaaway sa loob ng bahay, ay higit na nakakasakit kaysa kaaway sa labas.

3. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

4. Boboto ka ba sa darating na eleksyon?

5. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

6. The conference brings together a variety of professionals from different industries.

7. Masayang-masaya siguro ang lola mo, ano?

8. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

9. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

10. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

11. Hinde ko siya pinansin at patuloy lang sa pag kain ko.

12. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

13. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

14. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

15. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

16. Napakalakas ng kanyang halinghing dahil sa sobrang kalungkutan.

17. Tinignan ko siya sa nagtatanong na mata.

18. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

19. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

20. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

21. Papaano ho kung hindi siya?

22. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

23. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

24. Tahimik ang kanilang nayon.

25. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

26. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

27. Kinuha ko yung CP niya sa bedside table.

28. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

29. Iniuwi ni Rabona ang pusang iyon.

30. Aling hiwa ng baboy ang gusto mo?

31. Sinubukan kong gumawa ng kakanin gamit ang pulotgata, ngunit hindi ko nagustuhan ang lasa.

32. Let's just hope na magwork out itong idea ni Memo.

33. Les régimes alimentaires restrictifs et les comportements alimentaires obsessionnels peuvent nuire à la santé mentale.

34. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

35. She has started a new job.

36. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

37. La realidad nos enseña lecciones importantes.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Marahil ay nai-stress ka dahil sa mga kailangang tapusin sa trabaho.

40. pagkaraan ng kargang iyon ay uuwi na siya.

41. Nagsilabasan ang mga taong bayan.

42. Walang password ang wifi ng kapit-bahay.

43. Naglipana ang mga turista sa baybayin ngayong tag-init.

44. Ano namang inasikaso mo sa probinsya?

45. Sino ang kasama niya sa trabaho?

46. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

47. Bawat isa sa atin ay may malalim na koneksyon sa lahat ng ito, sapagkat ang panitikan ay bahagi ng kultura at buhay ng bawat isa sa atin.

48. Ano ang pangalan ng asawa ni Silay?

49. "Ang hindi marunong magmahal sa sariling wika, daig pa ang hayop at malansang isda" ay isang bukambibig na nagpapahayag ng halaga ng pagmamahal at pagpapahalaga sa ating wika at kultura.

50. I am absolutely committed to making a positive change in my life.

Similar Words

subject,

Recent Searches

subjectnakainsuwailsellingtopicsementonanunuribopolstog,piernagsamabetweenpinakidalainomcapitalistnagandahanmaulitmagbalikpitotoynandiyanbilinahulipinag-usapannakumbinsilibertariansolidifynagdalagitaralinggoprogramsformsmagkasing-edadcallnagpipiknikmakahirampacebilingnamumulotharapnapapadaanmakaratingreplacedencountersinagotdeterioratemestactivitydisappointmulmakakakaennilinistaingalightnabubuhaynothinguminomsamaupodyosamalasutlavirksomheder,communicatemagbigayannakapaligidpinagsikapankumananibinalitangeneropandalawahankasamahanmahirappasyentekilaypawisbairdibinubulonglalakengbigyannandyanharinginvestingmahiyaagilafametibokipinikitaniyamakahihigitipaghandanapahintonegosyantenagpakilalanagtinginanprofessionalpakakatandaanyelolabinsiyamlegendkasamaankinahayoppinabulaanputolclassesnambrasosearchiskedyulpagemaaliwalasbumagsakasignaturadinalafatalkababaihanbiluganginuulcermobilerawnasasabihanpaghaharutanjunionag-poutlearningtasaunidosexcusehinogwithoutpagsagotsharmainenanglupamartesnagngangalanginaabutankamustamagpalagokaklasekanyafloortupelosumasambaumanodurantemanananggalpaldapangalananinalalayanimaginationrestaurantnahihiloumigtadataquessumakayngisinaabotnalugodsurveyspagbatihinagisanitolightssakinkasodollarsuelomalumbayroonkataganakalilipastravelermagkikitaganangtotoofilipinapanalanginkarwahengricakatapataffiliatetrabahofestivalesescuelastag-ulankontranangagsipagkantahanmagbibigaytinggreatlyafternoonpupuntahandropshipping,partnerrenacentistatinaybevarenapakahangaipasok