Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "subject"

1. Cryptocurrency is often subject to hacking and cyber attacks.

2. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

3. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

4. Mathematics is an essential subject for understanding and solving problems in many fields.

5. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

6. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

7. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

8. The professor delivered a series of lectures on the subject of neuroscience.

9. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

10. Women have been subject to violence and abuse, including domestic violence and sexual assault.

Random Sentences

1. I received a lot of gifts on my birthday.

2. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

3. Madalas sya nagbibigay ng pagkain sa pulubi.

4. Many financial institutions, hedge funds, and individual investors trade in the stock market.

5. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

6. Palibhasa'y walang kalaro, ang mga hayop na lang ang ginawang libangan nito.

7. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

8. Ang pangamba ay isang emosyon na karaniwang nararamdaman ng mga tao kapag mayroong posibilidad ng panganib.

9. Sa huling pagkakataon ang mga isda ay nagsalita.

10. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

11. La labradora de mi amigo es muy valiente y no le teme a nada.

12. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

13. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

14. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

15. Ano bang pinagsasasabi mo jan Kuya?

16. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

17. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

18. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

19. The event was sold out, and therefore we couldn't get tickets.

20. My boyfriend took me out to dinner for my birthday.

21. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

22. Good morning. tapos nag smile ako

23. Ang aking Maestra ay napakabait.

24. Nag-aaral ang estudyante sa laybrari.

25. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

26. The culprit behind the vandalism was eventually caught and held accountable for their actions.

27. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

28. Isang Pinoy ang nanalo sa international singing competition.

29. Maaf, saya tidak mengerti. - Sorry, I don't understand.

30. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Dalawa ang pinsan kong babae.

33. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

34. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

35. Natawa sya, Nakakatawa ka talaga. haha!

36. Me duele la cabeza. (My head hurts.)

37. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

38. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

39. Sya ngayon ay isa nang ganap na doktor.

40. Nagkakatipun-tipon ang mga ito.

41. I have lost my phone again.

42. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

43. Hiram na libro ang ginamit ko para sa aking research paper.

44. My grandma called me to wish me a happy birthday.

45. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

46. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

47. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

48. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

49. Nasaan ba ang pangulo?

50. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

Similar Words

subject,

Recent Searches

subjectvampirespakelamcomienzanlaborpinalutooverallmaskoutbumugacharmingkumarimotsamupasokcomplicatedshowkaring1973developedjustdrayberroboticloriadverselydemocraticdatiexpectationsoftefuncionarclassroomcolourbarplaysbumabaatetopic,kararatingprivatesurgerylatertandacomecommunicationsmatabanalasingsafeipongsofacomputereevenbadingplanmichaelrelativelyimagingemphasisdinggindoongenerateelectronicmapadalidecisionsyangenforcingjoeerrors,addingprogrammingclientewhethertablestartedinterviewingambacallingspreadfrogbetaandreconstitutioncontentcreationmuchevilnariningnanghahapdivirksomheder,pagkakatuwaannakikilalangnagbakasyonmakapangyarihannakagalawnakaupoadvertising,kinauupuantaga-lupangnagpatulongreserbasyonmusicianhinipan-hipankonsentrasyontaga-nayonfotosnakakagalanaglipanangnagtutulakpagkakalutonakakasamanasasabihanpinahalatanagkwentonakapaligidtuluyanpagtataposkamag-anaknahintakutanbabasahinkumidlatmakikiligoinakalangatensyongpagsagotpambatangkaninumantumunogmaisusuotnamataydreamsculturasmabatongedukasyonipinatawaginakalaasignaturabosestinuturonavigationpagbebentamarketingonline,isinagotgiyeratenidoberetihihigitwakastienenpaglayassteamshipspakanta-kantangmachinespaggawadiseasesdyosabankebidensyacuentabarung-barongpanaytresmaisgabrielninyountimelysagingkarnabalsumapitdaangipasokbroadcastdaysinternacionalslaveipapahingabowmetodeledlockdownlistahanclockjunjunbilingcertainstoplightnicenagtatampoerapbiologinakatapatpinakidalakamandagmakakibokara-karakanakainomcruzpaulit-ulitproducenatinagnakaakyatnglalaba