Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "cake"

1. Ang daming palamuti ang nakalagay sa kanyang cake.

2. Ang galing nyang mag bake ng cake!

3. Ang laki ng wedding cake na ginawa ng kanyang ate.

4. Bibigyan ko ng cake si Roselle.

5. Gumagawa ng cake si Bb. Echave.

6. Gumawa ako ng cake para kay Kit.

7. He blew out the candles on his birthday cake and made a wish.

8. I baked a delicious chocolate cake for my friend's birthday.

9. I got my sister a cake and wrote "happy birthday" in frosting on top.

10. I have a craving for a piece of cake with a cup of coffee.

11. I love the combination of rich chocolate cake and creamy frosting.

12. I'm going to surprise her with a homemade cake for our anniversary.

13. I'm on a diet, but I couldn't resist having a small slice of cake.

14. It's a piece of cake

15. Kanino ka nagpagawa ng cake sa birthday mo?

16. Maganda ang ginawang dekorasyon sa cake ni Abigael.

17. My friends surprised me with a birthday cake at midnight.

18. My mom always bakes me a cake for my birthday.

19. Piece of cake

20. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

21. She carefully layered the cake with alternating flavors of chocolate and vanilla.

22. She decorated the cake with colorful sprinkles and frosting.

23. She surprised me with a cake on my last day of work to bid me farewell.

24. The cake is still warm from the oven.

25. The cake was a hit at the party, and everyone asked for the recipe.

26. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

27. The cake was so light and fluffy; it practically melted in my mouth.

28. The cake you made was absolutely delicious.

29. The children eagerly lined up for their share of the birthday cake.

30. The cutting of the wedding cake is a traditional part of the reception.

31. The wedding cake was beautifully adorned with fresh flowers.

32. We celebrated their promotion with a champagne toast and a slice of cake.

33. Would you like a slice of cake?

Random Sentences

1. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

2. Good morning din. walang ganang sagot ko.

3. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

4. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

5. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

6. The birds are chirping outside.

7. Sweet foods are often associated with desserts, such as cakes and pastries.

8. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

9. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

10. They are not shopping at the mall right now.

11. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

12. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

13. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

14. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

15. Pupunta si Trina sa Baguio sa Oktubre.

16. Ang kundiman ay nagpapaalala sa atin ng mga halaga ng pagmamahalan at pagka-makabayan.

17. Ipinagbibili ko na ang aking bahay.

18. Dancing all night at the club left me feeling euphoric and full of energy.

19. Masaya ang pakanta-kantang si Maria.

20. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

21. Sa pag-ibig, kahit gaano pa ito kalakas, kailangan pa rin ng respeto.

22. Ang mobile legends ay sikat na sikat sa mga pinoy.

23. They volunteer at the community center.

24. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

25. Acts of kindness, no matter how small, contribute to a more charitable world.

26. She admires her mentor's leadership skills and work ethic.

27. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

28. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

29. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

30. I got my sister a cake and wrote "happy birthday" in frosting on top.

31. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

32. Omelettes are a popular choice for those following a low-carb or high-protein diet.

33. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

34. His speech emphasized the importance of being charitable in thought and action.

35. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

36. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

37. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

38. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

39. Lasingero ang tawag sa taong laging nag-iinom ng alak.

40. Nanlaki ang mata ko saka ko siya hinampas sa noo.

41. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

42. Naniniwala ka ba sa legend ng academy?

43. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

44. The charity organized a series of fundraising events, raising money for a good cause.

45. Nationalism can be a source of conflict between different groups within a nation-state.

46. Mas maganda si Bingbing kaysa kay Jingjing.

47. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

48. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

49. Limitations can be frustrating and may cause feelings of disappointment and failure.

50. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

Recent Searches

cakekasiyahanduminag-alalataga-tungawkanilangbabatanimanradyonagsisunodtinakasannauwieyahappenedkinuhanapakagalingmangangalakalkumbinsihinkruspanunuksongpalibhasamanatiliorkidyaslaterkaysapatongpanikitapemetodemalitumamisulamwalkie-talkiepangingimidawpag-iyakulongoverbigasdalawabanalmaaaringsinakopagilakabuhayantawagsiyatag-arawmahirapraisepartnagtanghalianlendingkadalastumaliwasupworklitoadditionally,magsasalitamaaksidenteayagawaparipagsidlanpaghamakmabaliksilbingwesleydagat-dagatanhumahangosumanoordertherapymatalikbituinopdeltparingumuwigirlfriendkailangangconventionalpinaghandaantatlopaghuhugaspinaghalopatungoneedlesslibagsalamangkerobeenalapaapdesarrollaronpumatolmaipapamanamakakibokasomahiwagangmakakuhanazarenonapakagandangmakalabaspanalanginspendingownpulisincreasinglyculturamalawaksandalimagpalibremasipagsonidoestarnadamapag-uugalisinanakwhatevertatagalmapayapamatipunoteknolohiyaibabawbinigyangluiskagandalasingparangdadalawinhappierpangpyestaipinakitapangalancleargiyerapagepandemyabadlenguajeikinasasabiktalerestawranhatingweddinginatakebunsobumabagnagpuntahankumapitbroadnuevaimpactmagbabakasyonwastenerissaanjodoesgatashumiwapriestdiferentesrizalmaligayacapacidadesnakasuotmatandang-matandaditoconsumesannamnaminnagtitiiscramenag-emailmatumallumayasbayanposterdinalaweachkalimutansecarseyouthaudio-visuallynamumulaklakpagsisisilagnatmagalingnanlalambotimpitmoremungkahimaaarimagdalasarisaringlaruinerapnag-away-awaysaan-saanyumabong