Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "individuals"

1. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

2. Ailments can be a source of stress and emotional distress for individuals and their families.

3. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

4. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

5. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

6. Cancer can impact individuals of all ages, races, and genders.

7. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

8. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

9. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

10. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

11. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

12. Left-handed scissors are specially designed for left-handed individuals to ensure comfortable and efficient cutting.

13. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

14. Protecting the environment requires a collective effort from individuals, organizations, and governments.

15. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

16. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

17. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

18. The awards ceremony honored individuals for their charitable contributions to society.

19. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

20. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

21. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

22. This has led to increased trade and commerce, as well as greater mobility for individuals

Random Sentences

1. Facebook is a popular social media platform founded by Mark Zuckerberg in 2004.

2. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

3. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

4. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

5. Nakatingin siya sa labas ng bintana, waring may hinihintay.

6. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

7. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

8. Mabuti pa roon, kahit nakabilad sa init.

9. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

10. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

11. Naranasan ko na ang agaw-buhay na pakikipaglaban para sa aking mga pangarap.

12. Smoking is a leading cause of preventable death worldwide.

13. Go on a wild goose chase

14. Nag-aral kami sa library kagabi.

15. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

16. Ang pag-iwas sa mga diskusyon at pagtatangkang itago ang mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

17. I baked a delicious chocolate cake for my friend's birthday.

18. I am enjoying the beautiful weather.

19. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

20. Es teler adalah minuman dingin yang terdiri dari buah-buahan yang dicampur dengan sirup dan santan.

21. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

22. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

23. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

24. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

25. Maganda ang mga bulaklak sa tagsibol.

26. Los motores de búsqueda nos permiten encontrar información específica en línea.

27. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

28. I have never eaten sushi.

29. Einstein was married twice and had three children.

30. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

31. Gusto ko lang magpaalam nang maayos, kaya sana pwede ba kita makilala?

32. Nasarapan ako sa luto ni Chef Josh.

33. Napatungo ako dahil nangingilid na naman ang mata ko.

34. I sent my friend a bouquet of flowers and a card that said "happy birthday."

35. Nakita niya ang nagbabagang bulkan mula sa malayo, nagpapakita ng lakas ng kalikasan.

36. Game ako jan! sagot agad ni Genna.

37. Sorry.. pati ikaw nadadamay. E-explain ko na lang sa kanya..

38. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

39. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

40. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

41. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

42. Other parts of the world like Burma and Cuba also cultivated tobacco

43. Pwede mo ba akong tulungan?

44. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

45. Terima kasih. - Thank you.

46. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

47. Dumating na sila galing sa Australia.

48. Makikiligo siya sa shower room ng gym.

49. Hindi madaling mahuli ang mailap na pag-asa.

50. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

Recent Searches

oktubreindividualsnageenglishinuulcerpowerskumananvocalmatiwasaypag-uwimuntinlupapamanhikankawawangpag-irrigatetuluyanpa-dayagonalnamilipitdenpresidentialmamamanhikanmedicalpaghabakumakalansingnapakatalinokaininreahnagniningningnakikiainventioncontinuedbedshehekatotohananpangingiminagmasid-masidkaharianbilibidkagalakanenergy-coallovematindiradyoamazonulingmakapagsalitaleukemiagustongmarkedbarangaynauwihinugotorasannagsagawaiatftenidoumiwasjeepneypoloisiprecibirsariwaanihinsenadordagat-dagatanovermanymaskibilislordrooniwasanresearch,maritesmagka-babybilibmisyunerogratificante,lasongpeppypedengpapapuntanagpipilitritanapatunayanproductionnagbabalanapaplastikanbulakalakprimerabononapagtantonuevopnilitnakuhacontent:batalanconnectminu-minutobangkaisdakakaibangnapilitanghigpitanilihimnagkasunogletprogrammingsalitamalayongmisyunerongmagdamagannadadamaybestfriendnagtatanimpaanoimportantespesomalalimnagkakasayahanblessbeyondnahintakutanreportergiverbakasyonfallamaiconasawipangetperlanakaluhoddumatingleegdealmaabotitakbaldengsundalogayunmanctilesemphasizedkabilangpataysumabogpapasakabarkadaeducationmukagermanymagalingwifitangeksmag-ibagrabepagluluksasangabandamasipagsaan-saansinasakyanhealthcarrieskingprusisyonnagluluto10thgantingsongvetoramdamchoipagkaangatbakalumutangiparatingdireksyonnahantadbuwalmakapaghilamosnagdonundeniablemumuntingimpithesukristofathernagpadalafounddedicationpinaggagagawabodao-orderperpektingcongratskapamilyasabogsystems-diesel-runsaringbayadresumengumuglong