Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "success"

1. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

2. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

3. Despite his success, Presley's personal life was plagued by controversy

4. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

5. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

6. Money can be used for both needs and wants, and balancing these priorities is important for financial success.

7. Some people view money as a measure of success and achievement, while others prioritize other values.

8. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

9. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

10. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

11. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

Random Sentences

1. I have been watching TV all evening.

2. Kailangan magpakatotoo at humingi ng tulong kung hindi makakabayad ng utang sa tamang panahon.

3. Jeg har lært meget af min erfaring med at arbejde i forskellige kulturer.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

6. Mi vecino tiene una labradora dorada que siempre corre a saludarme.

7. ¿Cual es tu pasatiempo?

8. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

9. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

10. Ibinigay ni Ana ang susi kay Sally.

11. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

12. I have finished my homework.

13. Lügen haben kurze Beine.

14. Hinayaan kong maglabas ng malalim na himutok ang aking kaluluwa upang mapawi ang aking pangamba.

15. Ang laki ng bahay nila Michael.

16. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin at hamon na kinakaharap ng mga tao.

17. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

18. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

19. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

20. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

21. Tumama ang siko nito sa kanyang dibdib, sa kanyang katawan! Dali-dali siyang tumalikod at patakbong lumabas.

22. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

23. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

24. Namnamin mo ang halik ng malamig na hangin sa umaga.

25. When in Rome, do as the Romans do.

26. Ano ang gustong palitan ng Monsignor?

27. Malilimutin si Ana kaya lagi niyang nakakalimutan ang kanyang susi.

28. We finished the project on time by cutting corners, but it wasn't our best work.

29. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

30. Ano hong klaseng sawsawan ang gusto ninyo?

31.

32. Wag mo naman hayaang mawala siya sakin.

33. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

34. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

35. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

36. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

37. The students are studying for their exams.

38. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

39. Guten Abend! - Good evening!

40. Lumipad palayo ang saranggola at hindi na nila nakita.

41. His unique blend of musical styles

42. A couple of photographs on the wall brought back memories of my childhood.

43. The decision to release the product early was a risky but ultimately successful strategy.

44. Supporting policies that promote environmental protection can help create a more sustainable future.

45. Bestfriend! impit na tili ni Mica habang palapit sa akin.

46. The feeling of finishing a challenging book can be euphoric and satisfying.

47. This can be a great way to leverage your skills and turn your passion into a full-time income

48. ¡Muchas gracias!

49. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

50. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

Similar Words

successful

Recent Searches

successfacebooklabingbutihingtinderasisikatganaoutlinesbinibinidatapwataywanrailsumakitperlavideoprocesomeetingalaalatekstmatalinoilancompartenlindolsynligegodakmangcoaching:biggestspecialyeskalabanalas-diyesjohncaseswayscorrectinglumingonpracticadorestdecisionspangangatawanmauupoi-collectenforcingadditionallynalugipaslitbehaviordoingsettingprobinsyahitsuraconvertingpronounnamumulaklakpotaenasumalakayikinabubuhaymakapangyarihanwalkie-talkiekaninathereforeikinakagalitnagtagisanmaaarimuchnakaluhodpagpasensyahandyantinaymagkaibigannailigtasnagtuturopeoplekuwartosellingibonbasketbolkantapinakabatangmongcomputernakalilipasnanlilisikkumikinigmukhangpampagandanatitiyaknakatirameriendanagtatamponagmakaawaaraw-arawsang-ayonmagbabakasyonnagtitiiswowpunongkahoygeologi,napadungawnetohighestbalitaunibersidadninanaispagsisisipangungusappinagalitanteammagdoorbellnandayamangyaritalentednakabawitigrekumikilosstrategiesbairdgatheringpartyunattendedinjurymarasiganumiyakaabsenttungkodnaglaronangangakomaghihintaykakutispahabolnalugodnapansinsyamahabangfulfillmentgovernorstinanggalafternoonnatitirangnangingitngitnahihiloinihandauntimelyibabawalasshortpitumpongabanganleytenetflixnagdaramdamincidencepakpakteleviewingnoobinilibuslosupreme10thmatangmaalognilangtryghedfuecommunicateoverviewpapuntatooadddemocraticredstoplightitemsclockdependingtinginipinalitwhetherilingpresentbeautycarlousuarionaghuhumindigwinsitinaobkailanmanburmamagtatakapagigingbangkamaawaingsaan-saanrooncoloritinaasindustrykabosestuluyan