Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Anong oras gumigising si Katie?

2. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

3. Limitations can impact one's career, relationships, and overall quality of life.

4. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

5. The chef is not cooking in the restaurant kitchen tonight.

6. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

7. The acquired assets included a portfolio of real estate properties.

8. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

9. Sinuman sa kaharian ay walang makapagbigay ng lunas.

10. Napatingin ako sa orasan. 12 na ng madaling araw.

11. Si Jose Rizal ay napakatalino.

12. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

13. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

14. Madalas akong nagbabasa ng libro sa hatinggabi dahil hindi ako makatulog.

15. I absolutely agree with your point of view.

16. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

17. Iiyak ako pag hindi ka pumayag maging bestfriend ko.

18. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

19. Ano-ano pa po ang mga pinaggagagawa ninyo?

20. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

21. Limitations can be a source of motivation to push oneself to achieve more.

22. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

23. Ilang gabi pa nga lang.

24. Frustration can be a normal part of the learning process and can lead to personal growth and development.

25. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

26. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

27. Mathematical formulas and equations are used to express relationships and patterns.

28. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

29. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

30. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

31. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

32. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

33. Huwag na sana siyang bumalik.

34. Andyan kana naman.

35. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

36. Kailangan mong malalim na pumasok sa kanyang kaibuturan upang maunawaan mo siya.

37. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

38. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

39. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

40. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

41. Ku, e, magkano naman ang laman? ang tanong nga babae

42. Sa di-kawasa ay dumating ang malungkot na sandali.

43.

44. A wedding is a ceremony in which two people are united in marriage.

45. He admires the athleticism of professional athletes.

46. Naranasan ko na ang agaw-buhay na pakikipaglaban para sa aking mga pangarap.

47. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

48. It's important to read food labels to understand ingredients and nutritional information.

49. Then the traveler in the dark

50. Sa katagalan ng panahon ang lawa ay natuyo at may tumubong isang puno.

Similar Words

nuevos

Recent Searches

kontranuevomatandangbumalikfollowingtanyagumigibturonrecibiragostosakaylinacreditbalingansikipdialledheartbeatbirdscompletamentepnilitpelikulanaturallihimalakpulitikosakimtomorrowkutsaritangmganamatelefonsilyamarangyangeneroapologeticsawamaaariumaagossumigawtarcilabilikahilinganpetsangtwitchtradelandopisodangerouspalagimalamancardkabibiplacecontent,gamotelitenasabingcongrats1973spendingkitangjaneguardaspaghettijamestsaafonoginisingrefersinterpretingnatatawacomunesjoysutilsumapitpinunitstudentlikuranarbejderpinsanfrogdraft,makesbroadcastingimprovedmaratingoverviewsofaprogramspackagingyeahseparationwalkie-talkienagbabakasyonikinatatakotnakapagngangalitkaaya-ayangmagkaibigankasaganaannabalitaansalu-salopagkakayakapmagtatagaladvertising,alsotumambadinferioreskahaponnakasahodtinangkanagsisigawnanahimiktinatawagmang-aawitnagpipiknikdiscipliner,paki-drawingnaiyaknag-aagawannapakasipagpaumanhininilalabasnagawangsiniyasatpanalanginkakataposgumagamitnagbantaypinagbigyankuwadernotinutopnagcurvenakatagobuwenasnearmarketingnagsinekommunikerermakapalkuwentothanksgivingmakapaniwalaginamitkomedornagagamittuklastumahantumalimproductividadhandaannakakatandanakauwinaapektuhanitskampanabinuksannapililungsodkisapmatamagawanatabunandiyanmaglarombricoshumihingitsonggolikodnapawidireksyonsarisaringtsismosabilibidsasapakinbihiranuevosvaledictorianisinarauwakxviipadalascynthiasarongnapakapakibigaysaangunosadditionallynagwikangmabibingibarcelonaisasagotgatherkatulonge-commerce,tilisayaluboskayomatangumpaybantulot