Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

2. Pasensya na, kailangan ko nang umalis.

3. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

4. Los ríos y lagos son fuentes importantes de agua dulce.

5. Sino ang kinukuha ng mga sundalo?

6. Tumugtog si Jemi ng piyano kahapon.

7. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

8. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

9. Ano ang malapit sa eskuwelahan?

10. The singer on stage was a beautiful lady with an incredible voice.

11. Dahil sa aksidente, hindi na nakapagtapos ng pag-aaral ang biktima.

12. Cutting corners in your exercise routine can lead to injuries or poor results.

13. Have they fixed the issue with the software?

14. Ngumiti lang ako sa kanya at nagsimula muling halikan siya.

15. I took the day off from work to relax on my birthday.

16. Limitations can be cultural or societal, such as gender roles or stereotypes.

17. Les travailleurs peuvent obtenir des avantages supplémentaires tels que des bonus ou des primes pour leur excellent travail.

18. They are running a marathon.

19. Sweetness can be used to mask other flavors and create a more palatable taste.

20. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

21. We need to get this done quickly, but not by cutting corners.

22. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

23. Ang mga halaman ay dapat na pinapakain sa regular na may compost o fertilizer upang matiyak na sila ay may sapat na nutrients para sa paglaki

24. The children do not misbehave in class.

25. Pinanood ng bata ang babae habang ito ay kumakain.

26. Puwede makita ang schedule ng biyahe ng bus?

27. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

28. Amazon's customer service is known for being responsive and helpful.

29. Uncertainty is a common experience in times of change and transition.

30. He has been practicing the guitar for three hours.

31. Hinde naman ako galit eh.

32. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

33. Mabilis na pinabulaan ni Paniki na siya as isang mabangis na hayop; siya raw ay isang ibon.

34. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

35. Kailangan ko munang magpahinga para mawala ang inis ko.

36. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

37. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

38. Na-curious ako kaya't nag-google na lang ako upang malaman ang sagot.

39. My favorite thing about birthdays is blowing out the candles.

40. Inflation kann die Einkommen von Rentnern und Menschen mit festen Einkommen verringern.

41. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

42. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

43. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

44. Kapag nawawala ang susi, sinasalat niya ang bawat bulsa.

45. Sinabi naman ni Apollo ang mga dapat gawin.

46. Paliparin ang kamalayan.

47. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

48. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

49. Football players must have good ball control, as well as strong kicking and passing skills.

50. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

Similar Words

nuevos

Recent Searches

observation,binawianunospagsidlannuevomatandangnagniningningbutterflyself-publishing,anongbuhokminamasdanmadalingnasuklamexpeditedkumapitinnovationtengamaatimpinoy3hrsipatuloysinksinampalnilulonbuslotransmitsibinalitanglaroanaylalasoccertilllifeisasagotkinagalitanpaghalakhakmagasawangmakakatakaskwenta-kwentapoliticalgabi-gabinakakunot-noongpagamutanumakbayo-onlineabundanteactualidadfitnesssinasabinami-missmagdamagankapasyahankahuluganpagkainisinsektongmanghikayathumiwalaydoble-karanakasandignakapaligidmakapagsabinagkasunognag-angatmahawaannagmamadalit-shirtmahalgagamitkilaybirthdaypumikitligayamagpakaramiginawanginiresetatumindigtagpiangngitinagwaliscanteennakakaanimmaabutannatinagnakabluegawinpartspeksmanlumutangnangyaripaghuhugaskamandagqualityreleasedvisualinvolvepublishedmotiondumatingviewsoverviewipapahingapotentialdevicespumuntapinalutosumamaprovelabordalandaninantokshopeediamondiskobabessinunodcardbuwiskeeppaki-chargehinagud-hagodbobomakabiliprimerosgenerationerkaawa-awangsilangsulinganulomagselosika-50malambingmatangkadcontrolalapitanprinsipengamoynararanasanalignssiyang-siyamartialkategori,nagkakakainhimselfpinisilincitamenterbagalfriendsistersimbahanlawsmalinisdailymahiwagahapag-kainankulunganhagdananculturesinteractadventprovidedinspirasyonulamphilanthropynagtungoplatformse-commerce,sinuotbutiyumabongtemperaturadollyreportmagsi-skiingbalesagotkabilangumiimikamericapinangyarihancommunicationswalabumangonclientskababalaghangginoongfeedbackakmangfavorrewardingnaglabavaliosatanghalimanakbotienensiopaomaingatautomationenerosociale