Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

2. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

3. La menta es una hierba refrescante que se utiliza en bebidas y postres.

4. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

5. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

6. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

7. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

8. Kumanan po kayo sa Masaya street.

9. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

10. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

11. I reached my credit limit on the card and couldn't make any more purchases.

12. Nationalism can be a source of inspiration for artists, writers, and musicians.

13. Babalik ka pa ba? nanginginig na yung boses niya

14. Writing a book is a long process and requires a lot of dedication and hard work

15. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

16. A couple of dogs were barking in the distance.

17. Batman, a skilled detective and martial artist, fights crime in Gotham City.

18. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

19. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

20. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

21. La música también es una parte importante de la educación en España

22. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

23. Emphasis can help clarify and reinforce the meaning of a message.

24. Investing refers to the process of allocating resources with the expectation of generating a profit.

25. Nag shopping kahapon si Tita sa SM.

26. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

27. Ang parusang angkop sa suwail na anak ay iginawad.

28. Iwanan kaya nila ang kanilang maruming bayan?

29. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

30. Gustong pumunta ng anak sa Davao.

31. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

32. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

33. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

34. Natawa sya, Nakakatawa ka talaga. haha!

35. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

36. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

37. Gusto ko na talaga mamasyal sa Singapore.

38. Sa dakong huli ko lang narealize na mali ang ginawa ko.

39. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

40. Dogs can provide a sense of security and protection to their owners.

41. La vista desde la cima de la montaña es simplemente sublime.

42. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

43. Hindi ho, paungol niyang tugon.

44. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

45. Umiiyak ang langit sapagkat tuyo na ang lupa.

46.

47. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

48. Pumasok ka na lang sa kwarto. Susunod na lang ako..

49. Despite the many advancements in television technology, there are also concerns about the effects of television on society

50. Maraming tao ang dumalo upang manood kung mananalo ang matanda sa batang si Amba.

Similar Words

nuevos

Recent Searches

ginawangnuevosagothumalakhakpagkaimpaktofriesburmakaibiganphilippineisinaboymarioglobalisasyonwidepagtutolcrazyibinubulongibinaonpamilyaikinasasabikcaseswifinakauwigagamitinunitedbabespalayansumasayawoliviaeffortsnatitiyaksiko1929katutubonapabalitapasigawcontroversyinvitationimprovesenadornatingkaalamannanghihinamaddisenyongbumaligtadyukorobinhoodbilaolondonnaiinissagabalnagkatinginansigningsmagalangnalakiparatingjerrykatawangkumpletointerestdyanconditioningnagpalutonamumulamaramotnanahimikmawalarestawranfacilitatingreaksiyontinikpaghihirapitinanimtrafficpresence,librenakasabitdropshipping,binigyangnilangipinaferrerhawakanwalkie-talkiediwatadumaramidangerousnagsimulatuluyangattorneypagodpinagmamalakiipaliwanagmahiyanagandahanlargernagulatwithouttumamismangingisdangbairdpayongmessagemagpasalamatkwebangdonemagsisimulaotherstatlomahahaliktshirtkaraokehilingnageespadahangenechristmasumiyakmahusayyakappasensiyamesanakatuonkatabingnagngangalangbilibshoppingpagluluksamisusedtonyosuwailganalumamangjuniosiniganggeneratedstringmulingefficientaksidenteninyongmagsaing11pmsynculingmakalingsobrapumuntalumakastinionagniningningbayanihigh-definitionuugud-ugodmagasawangpinagsasabimatutongautomaticautomationmayabangnapakamotpaghuhugaspinag-aralanmoneyprogrammingsinongkakayanangmarketingborndumiipagbilipalmakulangeffektivtsanghastaumangatspeechundeniablebahagieuphoriccallinghoweverstatesmokerprocesotindahantusindvistahimiktumahimikengkantadanaantigtherapypagkainisyamansumalanagtalagakapatawaranroonrelolibertariangayunpaman