Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

2. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

3. We've been managing our expenses better, and so far so good.

4. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

5. All these years, I have been creating memories that will last a lifetime.

6. Reden ist Silber, Schweigen ist Gold.

7. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

8. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

9. Les problèmes de santé mentale peuvent avoir des effets physiques et sociaux sur une personne.

10. The website's loading speed is fast, which improves user experience and reduces bounce rates.

11. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

12. ¿Quieres algo de comer?

13. The guilty verdict was handed down to the culprit in the embezzlement trial.

14. Isang kakaibang ritwal ang nakita nila sa kagubatan kung saan nagsayaw ang mga tao sa ilalim ng buwan.

15. Cheap sunglasses like these are a dime a dozen.

16. Kucing juga dikenal dengan kebiasaan mereka untuk mengasah kuku di tiang atau benda lainnya.

17. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

18. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

19. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

20. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

21. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

22. No hay mal que por bien no venga.

23. He thought it was a big problem, but in reality it was just a storm in a teacup.

24. Ano ang nasa ibabaw ng palayan?

25. Ang aking kabiyak ay ang aking tahanan, kung saan ako nararamdamanang tunay na pagmamahal at suporta.

26. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

27. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

28. Hinugot niya ang kanyang kaisipan upang makaisip ng magandang solusyon sa problema.

29. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

30. The basketball court is divided into two halves, with each team playing offense and defense alternately.

31. Ano ang gagawin mo sa Linggo?

32. Tahimik ang buong baryo sa takipsilim.

33. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

34. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

35. Nang magbabayad ako ng pinamili ko't kapain ko ang bulsa ko, e wala nang laman!

36. Me siento caliente. (I feel hot.)

37. Maraming mga anak-pawis ang hindi makatugon sa kanilang mga pangangailangan dahil sa kakulangan ng oportunidad.

38. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

39. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

40. Wala naman akong sinabing ayaw ko ah?

41. Tahimik ang buong bahay, waring walang tao sa loob.

42. The United States is a federal republic, meaning that power is divided between the national government and the individual states

43. Kinabukasan ay nawala si Bereti.

44. Ani niya, wala nang makakatalo sa kanyang kakayanan.

45. She carefully layered the cake with alternating flavors of chocolate and vanilla.

46. Ang Ibong Adarna ay nagpapakita ng kapangyarihan ng kabutihan at pag-ibig sa pagharap sa masasamang tao.

47. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

48. Tumamis at sumarap ang lasa ng bunga.

49. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

50. Isinalang ni Pinang ang lugaw ngunit napabayaan dahil sa kalalaro.

Similar Words

nuevos

Recent Searches

nuevotupeloleadingailmentssentencedefinitivomagtipidinangtuvopasensyasitawkinakainlumapitvideospandalawahanhalikanmanalochristmaskakahuyannakagawianprogramsnagsunuranmagkaparehodonemayroonghumabipiyanomaibaallergymaihaharappinilitkagandanaputolkabighapaalamhumihingidiyosikatlongpasahekindergartenkassingulangmulighedsamfundindvirkningnagtutulakelepantereynakalakipahirapanmatamanproducts:bukodalingcafeteriaikinabubuhaytuwangwaitsatinlumitawjohngalakbuwalaywananongafteroverallfeelchadduricuentannangangaloghashulusystems-diesel-runplacehallcebuartificialkingkagyatsalesknowaddictionworkstaybumaligtadhigantenagsamasiguradopasaherospeechpogingpuntanasuklamnagtatakbomananahimaglalarocompletingapoanumanganumansilid-aralannerissagrancongratsofferaddressipipilitzoommasasamang-loobnaguguluhangaanhinbiocombustiblesnagbabakasyonritoreboundpaglayasnandiyannakakarinignagpabayadmakilingkayabangankatolisismojaninulitdamdaminbilisjacky---kinasisindakanencuestasnalalabinghanapbuhaynaliwanagannagbantaybabasahinminu-minutominamahaltatayoikukumparamagkaharapwouldvaledictoriansantoslumindolnapahintokagubatankanikanilangibinaonpictureshaponmanirahanpinatidbalitawednesdaypagkatmakinangsisterhagdanibinubulongbagamatalagangpinansinlandasdespuesngisiisinarasacrificekuwebakatagalansoontinikkulotumakyatanitokaugnayanumaliskatapatlumulusobyarinahihilohonpamanhydelprincepulubiduonlordsakinpag-indak1000centerayonburmatonightdreamtwitchmahahabamournedblazingpalagi