Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

2. Halos hindi niya narinig ang halingling ni Ogor.

3. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

4. Advances in medicine have also had a significant impact on society

5. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

6. Her album Thank U, Next was a critical and commercial success, debuting at number one on the Billboard 200 chart in 2019.

7. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

8. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

9. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

10. I admire my mother for her selflessness and dedication to our family.

11. Naglalaway ako sa amoy ng niluluto mong adobo.

12. Ikaw ang magnanakaw! Amin yan! Nasa ref ng bahay ko!

13. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

14. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

15. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

16. Salamat sa alok pero kumain na ako.

17. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

18. Nandito ang mga kaklase ni Raymond.

19. Naulinigan ng makapangyarihang Ada himutok ng Buto.

20. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

21. He has improved his English skills.

22. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

23. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

24. The candidate who wins the most electoral votes becomes the President

25. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

26. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

27. Hinimas-himas niya yung likod ko pagkalapit niya saken.

28. They have renovated their kitchen.

29. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

30. El invierno es una de las cuatro estaciones del año.

31. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

32. Nag tinda kahapon ang aking ina upang kami ay may makain ngayong araw.

33. Ang yaman pala ni Chavit!

34. Lakad pagong ang prusisyon.

35. The roads are flooded because it's been raining cats and dogs for hours now.

36. Claro, podemos discutirlo más detalladamente en la reunión.

37. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

38. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

39. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

40. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

41. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

42. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

43. El lienzo es la superficie más común utilizada para la pintura.

44. Since wala na kaming naririnig medyo kumalma na ako.

45. Ang pagpapakalat ng mga maling impormasyon ay nagpapakita ng pagiging bulag sa katotohanan.

46. Lebih baik mencegah daripada mengobati.

47. The French omelette is a classic version known for its smooth and silky texture.

48. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

49. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

50. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

Similar Words

nuevos

Recent Searches

asahannuevoandreagustongnangingilidsinungalingjobforskelbirdsmaglabapatongrecibirbopolsnamamagnifyvivapinagkasundopinagiigibtulangarkilaipinamiliiyanpaksamayamansigloasiaticpublishing,sumasakitnetflixlegislativeallowsthroughpamilyasikohopenatandaaninantayanitogoshklasrumokayuponagbasalingid1929haraplosscaretwitchnilinismemorialdvdlayassakinbusyangsubjectuncheckedtendermuntikancadenacongratspookdatiduriumiilingdevelopedmapuputibillpagpasensyahanmasasamang-loobkalupinapagtuunanriegaareacompartentuwidbubongipasokexperiencesipipilitfuncionarcommunicateibinibigaybringingkitipagtimplaipapainitlcddanceresourcestelevisedoperasyonpaparamikumantafigurasincreasesleadentertypesbehaviorpilingclientepuntastringpagkamanghascalepakikipagtagpoinilabasnamulatbreakelectionsopportunitiesalilainparisukatworkdayinterestbasuravasquescampaignslotpinahalatamarketplaceslakingnalagpasankalabanspeechesipinakitaturismopagigingtsupernaghihiraphawaknangyariengkantadamenossangausacrecerskabetogethercosechashindeguiltystoplightngumiwimatuklasansupilinbagkustatayomakakakainwouldnalulungkotintindihinrosapagkataoselluugod-ugodjannakaramdamsulinganpaglisanmahirapnapakatalinotipplasakaarawankumitaillegalgirltiniradorbehalfbinilimaaarinapakahabanangangalitkatulongnamataynakakamitmakikitulogupuansumalainabutantextkinalalagyanparinmalasutlakahalumigmigancellphonevotesmarinigvelstandviolenceinspiredthereanimagpapigilngumingisinaglarotravel