Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Ano ang kinakain niya sa tanghalian?

2. Mahalaga sa akin na mapaligaya ang aking nililigawan kahit sa maliliit na bagay lamang.

3. El autorretrato es un género popular en la pintura.

4. Napagod si Clara sa bakasyon niya.

5. Ang dami daw buwaya sa kongreso.

6. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

7. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

8. Yung totoo? Bipolar ba itong nanay ni Maico?

9. Medarbejdere skal overholde arbejdstider og deadlines.

10. Malamig sa Estados Unidos kung taglagas.

11. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

12. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

13. I know we're behind schedule, but let's not cut corners on safety.

14. Matapos magbabala ay itinaas ng matanda ang baston.

15. Botong boto sa kanya ang mga magulang ng kanyang kasintahan.

16. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

17. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

18. ¿Qué edad tienes?

19. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

20. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

21. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

22. Ang carbon dioxide ay inilalabas ng mga tao.

23. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

24. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

25. kami kumikilos mula sa kinatatayuan namin.

26. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

27. Pagkain ko katapat ng pera mo.

28. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

29. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

30. Tak kenal maka tak sayang.

31. The stuntman performed a risky jump from one building to another.

32. Ipaliwanag ang mga sumusunod na salita.

33. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

34. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

35. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

36. Sapagkat matagal na ring sumasamba sa mga anito ang mga katutubo, hirap na hirap si Padre Novelles na manghikayat.

37. Before a performance, actors often say "break a leg" to each other for good luck.

38. A lot of snow fell overnight, making the roads slippery.

39. The dedication of parents is evident in the love and care they provide for their children.

40. Einstein was married twice and had three children.

41. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

42. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

43. Tumakbo na ako para mahabol ko si Athena.

44. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

45. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

46. Nakumbinsi niya ang mga ibon at siya ay isinama sa kanilang pagdiriwang.

47. Tila maganda ang panahon ngayon para sa isang mahabang lakbayin.

48. Hindi sinasadyang naglimot siya sa kasunduan na kanilang pinag-usapan.

49. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

50. Babalik ako sa susunod na taon.

Similar Words

nuevos

Recent Searches

itinaasgumisingminahancreditnuevoreplacedteknologiexpensesbinibililunespatiencelihimphilosophicalkainismatikmangabiangelanapagodnahulaanforskelinimbitamatapangcolorabangansundaepinagkasundoinalagaanpebreroangalnenadesarrollarestilossupremereguleringsupilinattractivecomunicanlandokahilingandisselandmalakimulighedersumasakitkinagalitanabut-abotmasinopmaestratalaseekmaitimfakesnobmalapadipanlinisawaibigbatokdiamondboracaylossdemocratickaringnagreply197310thprocesoaalisreducedfridaypaywideboksingwallethomeworktsaaballbusvedcoinbaseminuteendingshowsorryrenombreassociationmagtataposkapilingmeaningngpuntatog,erlindavideos,garciaborndollarmapapamagingbumabadumatingnamespaghettisurgeryspeedellenefficientilingmakinggapcomplexmaratingmainstreamworkingcablefrogarmedsofakalalakihanmawawalanakaquicklymalinispisosulyapipanghampasattentionnakuhaniyanotlapatmagkapatidpagsisimbangatinproductionsumasayawkarangalanreboundpagtutolorderinomeletteinagawnuclearbevareartistapinyanagsisunodphilippineautomationspreadnaglinissuccessbalahibomalezanakatingalacompletepagtawamagsusunuranpagpuntaelectronicaksidentedrayberiyokonsentrasyonjoynapabuntong-hiningamag-asawangcitizenhangganghawakmuymapayapapinyuanbigasbumigaydiyosaformasnagulatdyipniuponangingilidpromotingadamaglutohumiwataga-suportamaglalabing-animnaliligomagnagtinginanechavebawalstringvehiclesctricasbatayconvertingpagkakatayogratificante,namumuongnagmamaktol