Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

2. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

3. Ang ganda ng sapatos ni Junjun.

4. Kung may tiyaga, may nilaga.

5. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

6. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

7. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

8. Tangka na niyang pagbubuhatan ng kamay ang matanda nang biglang lumiwag ang damit ng matanda at nagbago ang kanyang anyo.

9. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

10. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

11. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

12. Tinatawag niya ang anak ngunit walang sumasagot.

13. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

14. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

15. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

16.

17. Ilang taon ang lumipas at hindi pa rin nakikita ang gong.

18. Different types of work require different skills, education, and training.

19. Sikat ang mga Pinoy vloggers dahil sa kanilang creativity at humor.

20. Herzlichen Glückwunsch! - Congratulations!

21. Mabilis manakbo ang aso ni Lito.

22. Malayo ang tabing-dagat sa bahay namin.

23. Pumasok ako sa cubicle. Gusto ko muna magisip.

24. Sang-ayon ako sa panukalang ito dahil makakatulong ito sa mga nangangailangan.

25. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

26. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

27. In the early days, telephones were connected to a central switchboard, which connected calls manually

28. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

29. There are so many coffee shops in this city, they're a dime a dozen.

30. The king's legacy may be celebrated through statues, monuments, or other memorials.

31. Las hojas de los cactus son muy resistentes y difíciles de cortar.

32. Siya ho at wala nang iba.

33. Tumingala siya ngunit siya'y nasilaw.

34. Ikinagagalak naming anyayahan kayo sa aming kasal.

35. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

36. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

37. Cutting corners might save time now, but it will cause problems down the line.

38. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

39. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

40. Ofte bliver helte hyldet efter deres død.

41. Kailan tayo puwedeng magkita ulit?

42. Binentahan ni Aling Maria ng prutas si Katie.

43. Ang kaniyang pamilya ay disente.

44. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

45. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

46. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

47. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

48. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

49. Nagbuntong hininga sya, Akala ko naman.

50. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

Similar Words

nuevos

Recent Searches

nuevomagbubungaagossamupetsamagbungaphysicalbinabaanvedforcesmapuputihallpagkalapitguidanceallottedpulitikoanongprosesoahhhhprobinsyabirdsnewspapersmaghintayanilapangakovoresbernardoklasengkatapatayawrisekindsngisiasiatickriskaaumentarlasaricocareerseniormanuksogranadaltohmmmadobonahihilokarapatanmaibalikiyanpakpakfridayreducedtherapygalitatinoliviafurytools,janehumanobatinerissaimpitkitrepresentedtraininggeneratemetodeendmichaelfigurecrosspagtataposstuffedputiresultkararatinggamitnuclearaddageconventionaldragonfloorsequeandroideithermaratingrequirepracticesbackmediumtypesstartedhugismusicnaka-smirkfarmagkaibaelectroniclalakinglasnag-aagawanaplicarcynthiatiyankasalananmalamangimulataccessrelyipagbililorenareplacededadleytealintuntuninnaibabafeedback,organizehatingcommercekababayanspecificgloriaagadindividualelectedoftennananaginipwhybecomes1960swaaamatatalimmagtatamposweetahasnangingisaykarnabaltenidoyeheytelangnoobroadcastsbukodmaarilagispare1954kaganda1920smerrygenerositycarbonrepresentativeskesopaligsahanmaabutannagsamatilgangmagtatakatig-bebeintenasaanritopakainmulighedseekmagsinunodbisigandamingnakatunghaynangampanyakinatatalungkuangnagkakatipun-tipontuluyankonsentrasyonmaihaharappaga-alalacultivarkinagagalaknakaka-inmusicianmagpapagupitkalayuancrucialgandahannagpabayadkarunungankonsultasyonsaritadancenakahainmaligayapamasahenakakainganitokumalmalumamang