Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Magaganda ang resort sa pansol.

2. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

3. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

4. Marami kaming handa noong noche buena.

5. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

6. In 1977, at the age of 42, Presley died of a heart attack

7. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

8. Sweetness is an important factor in the culinary arts and food industry.

9. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

10. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

11. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

12. Samahan mo ako sa mall for 3hrs!

13. Lazada has a reputation for offering competitive prices and discounts.

14. Nagluluto si Andrew ng omelette.

15. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

16. Malayo ang tabing-dagat sa bahay namin.

17. Mapapansin kaya sa dami ng 'yong ginagawa

18. Storm can control the weather, summoning lightning and creating powerful storms.

19. Les enseignants peuvent utiliser des outils technologiques tels que les tableaux blancs interactifs et les ordinateurs portables pour améliorer l'expérience d'apprentissage des élèves.

20. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

21. Hiram na kasuotan ang ginamit niya para sa theme party.

22. Hinawakan niya ito sa isang bisig at sa pagdidilim ng kanyang paningin ay pabalingat niyang pinipilit sa likod.

23. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

24. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

25. Ang mga bata ay lumabas ng paaralan nang limahan.

26. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

27. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

28. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

29. Iinumin ko na sana ng biglang may umagaw.

30. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

31. The stock market can provide opportunities for diversifying investment portfolios.

32. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

33. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

34. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

35. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

36. They have adopted a dog.

37. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

38. She has written five books.

39. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

40. She speaks three languages fluently.

41. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

42. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

43. Ang paglapastangan sa ating mga tradisyon at kultura ay isang pagkawala ng ating pagkakakilanlan.

44. Pangit ang view ng hotel room namin.

45. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

46. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

47. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

48. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

49. Dedication is the driving force behind artists who spend countless hours honing their craft.

50. Ang paggamit ng teknolohiya ay nagbibigay daan sa iba't ibang uri ng hudyat, tulad ng emoji sa text messaging o facial expressions sa video calls.

Similar Words

nuevos

Recent Searches

ginawangnuevokatabingkumatokinspirationkahusayanmakauwitreatssuskilounderholdernagliliwanagplasaideasmagbigayantransmitsipapahingapumikitcardpinalutokirbynathanpasaheromaabutanfonoscasessinasabinapuyatexcitedmayamananilanovellesnuevostagumpayellamagtiwalaabutannakabaontssspakiramdamkapitbahayinimbitatsaaenviardisfrutarkangkongpaslitorugatilganghahatolbigotekumapitpamumunonagkakasyainformedpookchavitnagcurvenagdasalhayaanteninterests,befolkningen,karatulangkampanapadalassakupiniligtascitystorysportsartistentranceyouthhinanakitpang-araw-arawmadamitradeuusapankamandagbelievedboboerlindaskirtnakapasatumagalpamburarimaspangyayaririyantaga-hiroshimapinasalamatansusunodmamayangestilosinastanakahugmagkakaanakpagsasalitaeveningika-50manggagalingikinakagalitbintanakinahuhumalingandeathgatasnalalamankilongfianaroonbisigjulietbiocombustiblesnaghilamosheartbeatcongratskinakaintripiniangatparomagulayawbalebarrierswashingtonnangapatdanmagtagohusojunioganda10thputoltwitchnararapatbinawisantoswalispasalamatancoaching18thnasuklamdurimaghintaykailangantrafficcryptocurrencypahahanapnagkapilatreorganizinginuminlalongibinentaibilisinunodgenerationeraaliswordspayongmaibibigaypumatolposternatanggapsequeadditionhomeworkbasanalugmokmarielautomaticnag-replyinhalelenguajealexandernamumulotmanagertandangdecisionsmedidapalibhasaatestateilangbagkus,sumalaevolvedsasakyanbagogalawsapotgamessemillasmahahaliknakapagreklamomakapangyarihanbibilipagkabiglaeconomicnakikini-kinitacultureskatapat