Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

2. Napatulala ako sa kanya. Di ko alam ang isasagot ko.

3. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

4. Ang kakahuyan sa paligid ng aming tahanan ay nagbibigay ng kahanga-hangang mga tanawin sa tuwing taglagas.

5. Tumamis at sumarap ang lasa ng bunga.

6. La science a permis des avancées significatives dans la médecine.

7. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

8. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

9. Magandang Umaga!

10. Diving into unknown waters is a risky activity that should be avoided.

11. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

12. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

13. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

14. Tumayo yung lalaki tapos nakita niya ako.

15. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

16. La guerra contra las drogas ha sido un tema polémico durante décadas.

17. Ah yun ba? Si Anthony, taga ibang department.

18. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

19. Ang mga pook na mayabong na mga bulaklak ay karaniwang pinupuntahan ng mga turista.

20. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

21. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

22. Ang huni ng mga Kuliglig at kokak ng mga Palaka ay sumasaliw sa awit ng mga Maya.

23. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

24. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

25. Mathematical formulas and equations are used to express relationships and patterns.

26. Bakit siya ginaganoon ni Ogor?

27. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

28. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

29. Halatang takot na takot na sya.

30. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

31. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

32. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

33. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

34. Athena ang aga aga nakasimangot ka na kaagad.

35. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

36. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

37. Kalahating pulgada ang kapal ng pakete.

38. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

39.

40. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

41. She has been learning French for six months.

42. Negative self-talk and self-blame can make feelings of frustration worse.

43. Lumaganap ang hinagpis sa buong nayon nang malaman ang pagkasawi ng mga mangingisda sa bagyo.

44. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

45. They served a mouthwatering strawberry shortcake for dessert.

46. He has traveled to many countries.

47. Lumiit ito at nagkaroon ng mga mahahabang paa.

48. She complained about the noisy traffic outside her apartment.

49. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

50. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

Similar Words

nuevos

Recent Searches

nuevobutterflyincrediblearegladomaatimalagatanawkatulonge-commerce,tamadtayobanlaghasanghelhangintagaroonsistermayabonglangkaymatesatangansalesbookswatawattoyknightenergiadvancecarmenpangkatproducts:matigasbigongkatagalanedsapsssaffiliatekahilinganconsumesaraeclipxecarbonnaglabanantupelobusybinilhanbasahinpangittradehouseiiklieducativasnilulonespanyangaling1000pitohangaringgearpinatidipaliwanagomgpopularizewalngfuelconvertidascompostelaulamcongressbilinmegetmoodpostcardbipolarschoolspookgalitstevereservedanimosciencelegislativetrippasangknowsmakikipag-duetoconventionaleksenapupuntaagilitytsaaenchantedngpuntamapakaliinalokipipilitaggressionbeginningdevicessedentarybornpapuntateamalepersonsoverviewstagecasesstatingworkdaypuntanothingseenapolloqualityfencingconditioningmatutongbinawianmananahirangecuandoservicesfeedbackstructureandycontrolledmethodsgoingelectediyopagngitibumabalotmagbabagsikumigtadtinatanongasahandaangsilangmangingisdangnandoonnagawanggumawanaglokomauliniganlalaketilskrivesmakapagempakenaglakadbowlmagagandangnaliligokananrequierenfollowingnauntogmagandang-magandanagplaysana-allabutankaniyatiyakbalatpondocelulareslalakikatandaandalawangusonaglahopositionertonightincreasegovernmentgospelskillmagsasalitanag-oorasyonnagkakatipun-tiponhalamaisipdiretsoipagpalitexcitedtulisannunconservatoriosnamumukod-tanginakikilalangdiwatapinalayastrainsnakabaonnapastatenagsilapitnakapagngangalitpagluluksanagsisipag-uwiantinatawag