Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

2. She has quit her job.

3. Pasensiya na kayo, Ale, sabi ng bata.

4. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

5. Masaya pa kami.. Masayang masaya.

6. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

7. Tumakbo na ako para mahabol ko si Athena.

8. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

9. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

10. Marami silang pananim.

11. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

12. Pagkatapos ng isang daang metro kumanan ka.

13. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

14. Utiliza métodos orgánicos para combatirlas, como el uso de polvos de hierbas o infusiones

15. Napakabuti nyang kaibigan.

16. Durante la época renacentista, se desarrollaron las primeras formas de música instrumental, como la guitarra y el clavicémbalo

17. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

18. Nous avons décidé de nous marier cet été.

19. Ano ang ginugunita sa Thanksgiving Day?

20. They offer rewards and cashback programs for using their credit card.

21. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

22. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

23. Higupin mo nang dahan-dahan para hindi ka mabulunan.

24. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

25. Nagsusulat ako ng mga ideya at kaisipan sa aking diary.

26. Limitations can be physical, mental, emotional, financial, or social.

27. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

28. It is important to have clear goals and expectations in the workplace.

29. Iiwan lang kita pag sinabi mong iwanan na kita..

30. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

31. Makinig ka na lang.

32. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

33. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

34. Mathematics is an essential subject for understanding and solving problems in many fields.

35. Sinabi ng guro na mayroong eksaminasyon sa susunod na linggo.

36. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

37. Sasambulat na ang nakabibinging tawanan.

38. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

39. He has become a successful entrepreneur.

40. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

41. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

42. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

43. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

44. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

45. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

46. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

47. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

48. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

49. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

50. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

Similar Words

nuevos

Recent Searches

nuevopuwedetinapaypeppybalotathenainalagaanwednesdaythroatnasuklamnapatingaladumaanninonghappenedalayiyonjocelynnaiinitanriyanfriendshomesangkanboholeclipxekumukuloilawpasigawmrsnakapuntahumansmadurasnunogamitinpatipalaywashingtonleopoloclientskadaratingbairdbusiness,numerosasgatheringtendervitaminhastayouadditionkwebangwordscryptocurrencyprocesooverallyansueloideyareservationrosesoonglobaldatiroleetovasquesteamlinecommunicationprovideellademtirahanreadingnothingcakedingginschoollightsferrerkapangyarihandeletingsupportkasingmaghahabielectedpracticesjohncircleevilonlylihimhalikparurusahanbinginagpasanmagalingpasukantanongtotooallowskoronabutmeronkakauntogestápatawarinbinilipapasoksquashngunitnakakatabaganoonpioneerbumibitiwhitasasabihinpinapasayadadalawinmakapagsabimerchandisesayakinalimutancompletamentesidobanlagbayangnangingitngitcultivareskuwelaerhvervslivetpamahalaanikinalulungkotnagpipiknikeskwelahannakikini-kinitapagkakapagsalitanakakapagpatibaycultivomaipantawid-gutompinakamahalagangabalakalakihanmagpalibrerevolucionadohinipan-hipanmedya-agwamakapangyarihansandoksumusulatmakabilikisspinapataposmakukulayairportmakaraanbilibidnasilawkatolisismonatanongnasaangnagsamataglagasgiyerabalitananghuhulimatandangnangingisayminervietalinojeepneypigilanmagkabilangnapakamakatibarongbinabaratkusinakababalaghangmenschristmaswatermakinangindividualspa-dayagonaldesarrollarrabbagigisingbulongconsuelomasdangisingpinyaallowinginiwanloansreachlinggobilaosamakatwidtarcila