Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

2. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

3. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

4. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

5. Hindi ka sigurado sa desisyon mo? Kung gayon, pag-isipan mo itong mabuti.

6. Algunas personas coleccionan obras de arte como una inversión o por amor al arte.

7. Adequate fiber intake can help regulate the digestive system and maintain gut health.

8. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

9. Napadami ang inom ni Berto kaya't ito ay nalasing.

10. Kailangang di niya malimutan ang araw na ito.

11. Drømme kan inspirere os til at tage risici og prøve nye ting.

12. Franklin Pierce, the fourteenth president of the United States, served from 1853 to 1857 and was known for his support of the Kansas-Nebraska Act, which contributed to the outbreak of the Civil War.

13. Saan siya nagpa-photocopy ng report?

14. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

15. Sa parke, natatanaw ko ang mga tao na naglalaro at nagpapahinga sa ilalim ng mga puno.

16. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

17. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

18. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

19. Sus gritos están llamando la atención de todos.

20. The company's financial statement showed an increase in acquired assets.

21. En invierno, los días son más cortos y las noches son más largas.

22. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

23. Mukhang masarap ang prutas ngunit wala sino man ang mangahas na kumain nito sapagkat ang mga bunga ay lason.

24. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

25. Umihip ang malamig na hangin, waring may paparating na masamang balita.

26. Good afternoon po. bati ko sa Mommy ni Maico.

27. Ang pagkakaisa ng buong nayon sa panahon ng krisis ay lubos na ikinagagalak ng kanilang lider.

28. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

29. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

30. Nagtataka ako kung bakit ganito ang mga nangyayari sa mundo ngayon.

31. Saan nyo balak mag honeymoon?

32. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

33. Sino pa, isisingit ni Ogor, di si Dikyam!

34. Kailangan mong malaman kung sino ang mga taong bukas palad sa iyo upang hindi ka masaktan.

35. Masyadong maaga ang alis ng bus.

36. Sweetness can be a source of comfort and pleasure for many people.

37. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

38. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

39. Narinig kong sinabi nung dad niya.

40. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

41. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

42. Kailangan natin ng mga kubyertos para makakain ng maayos.

43. Musk has faced controversy over his management style and behavior on social media.

44. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

45. Disfruto explorar nuevas culturas durante mis vacaciones.

46. I am not exercising at the gym today.

47. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

48. Work is a necessary part of life for many people.

49. Ayaw sumindi ng ilaw. Pundido na yata.

50. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

Similar Words

nuevos

Recent Searches

nuevonilolokonahigaonlinelandoalas-tresskaybilisnakauslingkilotinutopnag-aalaypinag-aaralanprospermatamiskumaripassambitrepublicawaynakapikitpinagsikapanpunongkahoykakuwentuhannagliliyablimasawaerappulishmmmmtshirtkatedralneed,transmitidaslaybrarimalihisanitoubokatuladkagabimagpapagupitmakipag-barkadapinapasayapumapaligidnamumulotpagdukwangikinakagalitsalepangangatawanpinagbigyanmakuhangpangyayarikapasyahankalalaronagtalagatungawkalayuankababayangtumamisnangapatdannaglaroamericamagkasakitsasakaycorporationapatnapugovernmentculturesnaiinispagguhitkaliwapagsayadnakilalaprincipaleskumampievolucionadokoreatumindigbirthdaytinatanongnabigyanfulfillmentnagbibigayanlabissukatinydelsermaaksidenteadvertisingsumasakaysakophinagismaluwaguniversitiesperoanghelelenarabbatagaroonbulongpagkaingtinapay3hrspalapagbalotlenguajenuhpusabinibilangsinemagigitingmataraysaraiigibasabarnessantobigoteramdamallottedlayasbatomediakahiteffektivmatangconvertidaslorijackybernardomalagomisusedsumasambamaalogkilaladoonlayout,redreportbulsareservedmaaringfriesfloorbuspumupuntamonitormakakakaenumarawarmedenterheftytipletdosonlyspeedclosenagmungkahihawlaebidensyaanimunti-untiplankayabalik-tanawpamamasyalpasahenakituloggamitinmarunonglangrelykinikilalangkutsaritangpagdamitiyankabuhayanpinaghihiwaexhaustedfurklasrumeffectsdrewpracticadobeautifulwashingtononline,doble-karakulturcultivongipinbagkus,daysgamotdangerousnagpabayadmusmosspecializedbusinesseskasamadomingolangkaynagbakasyon