Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "nuevo"

1. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

2. Después de haber ahorrado durante varios meses, finalmente compré un coche nuevo.

3. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

4. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

5. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

6. El nuevo libro de la autora está llamando la atención de los lectores.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

9. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

10. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

11. La Navidad y el Año Nuevo se celebran en invierno.

12. Las hojas de papel se pueden reciclar para hacer papel nuevo.

13. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

14. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. El dueño de la granja cosecha los huevos frescos todas las mañanas para su negocio de huevos orgánicos.

2. Pasensya na, masama ang pakiramdam ko.

3. Nakakatakot ang kanilang lugar sapagkat andaming adik.

4. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

5. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

6. Nahulog ang saranggola sa puno ng mangga.

7. Mabilis na lumipad ang paniki palabas ng kweba.

8. Binili ko ang bulaklak para kay Ida.

9. Hay naku, kayo nga ang bahala.

10. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

11. The project gained momentum after the team received funding.

12. The professional athlete signed a hefty contract with the team.

13. Bukas na daw kami kakain sa labas.

14. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

15. Nació en Caprese, Italia, en 1475.

16. May I know your name for networking purposes?

17. Le musée d'Orsay est un incontournable pour les amateurs d'art.

18. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

19. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

20. Pagputi ng uwak, pag-itim ng tagak.

21. Ituturo ni Clara ang tiya niya.

22. Ang mga biktima ng paggamit ng droga ay dapat bigyan ng tulong upang maibalik ang kanilang kalusugan at makabalik sa normal na buhay.

23. Hindi lahat ng kaibigan ay laging nandyan.

24. Madaming squatter sa maynila.

25. Ano bang sakit niya? Inuulcer pa rin ba siya?

26. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

27. The teacher assigned a hefty amount of homework over the weekend.

28. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

29. Sinong may sabi? hamon niya sa akin.

30. Tuwid ang tindig nito at halos hindi yumuyuko kahit may pasang balde ng tubig; tila sino mang masasalubong sa daan ay kayang-kayang sagasaan.

31. May notebook ba sa ibabaw ng baul?

32. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

33. Before television, most advertising was done through print media, such as newspapers and magazines

34. Ilang tao ang nagpapaitim sa beach?

35. Bis morgen! - See you tomorrow!

36. "You can't teach an old dog new tricks."

37. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

38. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

39. A couple of friends are planning to go to the beach this weekend.

40. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

41. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

42. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

43. Me duele al tragar. (It hurts when I swallow.)

44. The impact of the pandemic on mental health has been immeasurable.

45. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

46. The authorities were determined to find the culprit responsible for the environmental damage.

47. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

48. Sumasakit na naman ang aking ngipin.

49. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

50. Inalagaan ito ng pamilya.

Similar Words

nuevos

Recent Searches

nuevoadvertisingasahanilawsuotisdangmartianlumiwaglakadbutihingsarateachingssalatkuyalarongricoimportantereynahinahangaanbulaknocheknightcommissionkahitbumabahacomienzancombinedmayabangpootkadalasstaplemagdaallottedconcernskumaripasabstaininginispakpakmakisigcrameperwisyonagdalabasketbolhellopuntaaggressionwebsitenevermataasbalitamagkikitapaidbyggettagalbumalikfuncionesmarieflamencongamalumbaysusulitpalibhasahagdangraphicfilmsduonusoprincereachcoaching:reservationzoometonaabotdenmentalcongratssumisiliplayuanbirthdayhatemagkaibapinagtagpomakikipag-duetosilay1982nakakabangonnakagalawsampungsinaliksikkapangyarihanipinatawagnaiilangdekorasyonkanangpasasalamattiningnanpuedenanaylegendstiketipatuloybinibiniresignationmagulayawanakcomunicarsenegativegabeofferdelemapuputiregalopanamaokaymedidaailmentsstrategiesnakakatulongwalanapakamotenglishkalayaanlimangalakpananglawpambahayninabarrocovitaminmasukoldakilangmagpalagoantokmiyerkulesnapilitangpasyalankatienapadpadpistabiglangsanayhigitandamingpanaysmallfacehastadevelopmentmarangyangpag-amincertaintypeskabuhayanfatherpagdatingkakuwentuhannakatunghayganidnamumulotsiniyasatlumapitmakipag-barkadanabighanikonsultasyonpronounbayadreducedpnilitnatakothinanakitbibigyanseekhalakhakhawlacourtmagkaharapculturesinasadyaganapinunittabitinapaynakikitangdaanpumitasemphasisnangangalitsignag-aalangannakauwibaku-bakonghubad-baromabihisanpiecesmoneynakapagsabinauliniganmagsimulaumaalis