Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "rhythm"

1. Emphasis can be used to create rhythm and cadence in language.

2. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

Random Sentences

1. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

2. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

3. The power of a single act of kindness can be immeasurable in its impact.

4. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

5. Tesla's vehicles are equipped with over-the-air software updates, allowing for continuous improvements and new features to be added remotely.

6. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

7. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

8. Hindi ninyo madadala sa hukay ang yaman ninyo.

9. Emphasis is an important component of artistic expression, such as in poetry and music.

10. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

11. Mura lang pala ang bili nya sa kanyang damit.

12. En algunos países, las personas solteras celebran el Día de San Valentín como el Día del Soltero.

13. Dahil sa sarap ng lasa, nahuhumaling ako sa pagkain ng mga matatamis na pagkain.

14. Si Imelda ay maraming sapatos.

15. Paano ho ako pupunta sa Palma Hall?

16. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

17. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

18. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

19. Bumili si Andoy ng sampaguita.

20. Ano na nga ho ang pamagat ng palabas ninyo?

21. Lagi na lang lasing si tatay.

22. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

23. Paano magluto ng adobo si Tinay?

24. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

25. Kucing di Indonesia sering diberi nama dengan arti yang unik dan lucu.

26. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

27. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

28. El algodón es un cultivo importante en muchos países africanos.

29. The foundation's charitable efforts have improved the lives of many underprivileged children.

30. He admires his friend's musical talent and creativity.

31. Napakabango ng sampaguita.

32. All these years, I have been working hard to achieve my dreams.

33. Limitations are the boundaries or constraints that restrict what one can or cannot do.

34. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

35. Nous avons choisi un thème de mariage champêtre.

36. Hinde no. Baka kasi pag tumaba ako ipagpalit mo ko bigla eh!

37. Det er vigtigt at give børn en kærlig og støttende opvækst.

38. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

39.

40. My grandma called me to wish me a happy birthday.

41. There are many different types of microscopes, including optical, electron, and confocal microscopes.

42. From its early days as a technology for the elite, to its current status as a staple in most

43. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

44. TikTok has been banned in some countries over concerns about national security and censorship.

45. She has excellent credit and is eligible for a low-interest loan.

46. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

47. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

48. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. He is running in the park.

Recent Searches

pshtondalandanleytelatestwowrhythmencompassesngunitnagpanggapkahaponmahababiroaralprivatepangulotandaiconspabusfindnakasuotgreensamucompartentripfacebookpakpaksorrynaritofatalplatformsfaritinuringconnectionpreviouslyellenplayschambersbulaenforcingbulsacigaretteroleidea:sakupinfallilingyeahtablewithoutmagbubungastoplightconsiderfeedbackandyhighestfallaeasyarmed2001kayainventionparkingcontestpaki-basadispositivopaga-alalamagkikitapracticesmahiwagangmaramdamanbloggers,sundaloincluirbangkongmagpaniwalahiramnakabaonlalongtinalikdankaynagbibigaytuwang-tuwaboteallowingmaarawhapdinahintakutanmeriendabenefitsnangangahoyganitomagitinglibertariandescargargymlangitdinigkamayiniresetatumalikodgalaanmaaliwalasdownkelanbinawisiembranami-misskuyakumatoksasagutingamitinpogiasiaticyandenipinasyanginternakahongmakisuyoaga-agapapagalitanchristmasbagamatpagongnakakapagtakapotaenagabi-gabipartiesmagbigayrumaragasangininomsubalitpinakidaladiliwariwnakabawisagasaanfridaypagngitisinapakidaraanginaganapsighumokaytumagalbibilhinpagpapasakitarabiamalasangkingkailangangmarkbaduypaanoonline,taga-tungawmay-bahaynagliliwanagngumingisimatanggapkaarawantamadmustpag-iinatgumawatotoongfirstisinumpakinantapinapasayapollutionspecialbumahatondoh-hoytelajeromekitlarokangnatulalacaracterizaglobalbumigayhiningistevekailannapatunayanpartdvdiigibmabilismaputulanvirksomheder,advancementscoinbasenalalabingkaalamanwaring