Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "naiilang"

1. Babasahin ko? medyo naiilang kong sabi.

2. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

Random Sentences

1. Ang bata ay na-suway sa kanyang magulang nang hindi sumunod sa kautusan.

2. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

3. Maraming bagong laruan sina Justin at Andre.

4. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

5. El acceso al agua potable es un derecho humano fundamental.

6. Salamat na lang.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

9. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

10. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

11. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

12. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. Bis bald! - See you soon!

15. Nag shopping kahapon si Tita sa SM.

16. Más vale tarde que nunca.

17. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

18. It’s risky to rely solely on one source of income.

19. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

20.

21. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

22. He is not taking a photography class this semester.

23. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

24. Balak po naming bumalik sa susunod na linggo.

25. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

26. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

27. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

28. Work can be challenging and stressful at times, but can also be rewarding.

29. When in Rome, do as the Romans do.

30. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

31. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

32. Tumakbo na ako para mahabol ko si Athena.

33. **You've got one text message**

34. Nakita niya ang isang magandang babae sa kaniyang harapan.

35. Saan pupunta si Larry sa Linggo?

36. After finishing the marathon, the runner was euphoric with their achievement.

37. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

38. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

39. The uncertainty of the weather has led to the cancellation of the outdoor event.

40. Nag-iyakan ang dalawang batang sina Maria at Jose.

41. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

42. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

43. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

44. It’s risky to eat raw seafood if it’s not prepared properly.

45.

46. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

47. Many people work to earn money to support themselves and their families.

48. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

49. Pumunta si Clara sa bahay ni Maria.

50. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

Recent Searches

naiilangumuwilinggongmontrealencuestasmedikalpaghaharutansharmainenasiyahanunattendednovellesmaranasanmakausappangalanannagpasanmatutongmaya-mayamakisuyopawisnaawatiniklingtsonggoputahetechnologicalareatsinelasbevarebuenainantaynapatinginfauxdefinitivoplasathanksitawmariamaistorbofatherlaamangnapilitangdiaperkapalsidopalapagmaligayamaghatinggabilaganaputilizansementomagnifywayssumisilipkasicarlonakinigfe-facebookreviewjennycareerpaldafiverrsandaliwordallotted00amdreamgrinsgenesakalingtiketdyipasthmaskypenakatingingtools,fridaychoicecommissionexamconectadossystematiskdawipanlinisprimermalapadmarahilexitpinilingdinalaartificialrestfarstudentsfeelingbadtwinklebigsumalikararatingschedulebarriersonceaudio-visuallytomarpakpakdyanmatangboteclienteautomaticreallyscaleleftstopwhygenerationsipagtimplabathalalikelymarkedasoulitjoshmakapaibabawmay-bahayayokotunaybagonglumiwagakokalakihanpupuntahanmulubos-lakasbundokpinapataposi-collectmasaholtinawagsakenmayroonoutlineskagandahanvidtstrakttelephonemalayongkundimannagawangsiyamrebolusyonnagdalanagsimulakendtnagbungasinagottinikpunong-punonagwikangboholbinilipunong-kahoysulingansincebagkus,workdaynapapadaankanilausejunioikinatuwanaliligonaiiritangdadalawpakakasalankuripotkakutiskatutubokaramihannakalockkaninotvsmacadamiaactingpasangcongratstripbilisayudawatchunderholderhumanotabledevelopbilingtworequiremastercallingdraft,services