Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "executive"

1. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

2. The executive branch, represented by the President of the United States, is responsible for enforcing laws

3. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. Medarbejdere skal overholde arbejdstider og deadlines.

2. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

3. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

4. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

5. El perro de mi amigo es muy juguetón y siempre me hace reír.

6. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

7. Muli niyang tiningnan ang nakabulagtang si Ogor.

8. Mathematics can be used to model real-world situations and make predictions.

9. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

10. Hindi mo na kailangan ang magtago't mahiya.

11. Kung saan ka naroroon, doon ka maglingkod.

12. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

13. May mga salarin na gumagamit ng iba't ibang modus operandi upang mabiktima ang mga tao.

14. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

15. Después de una semana de trabajo, estoy deseando que llegue el fin de semana.

16. Si Tom ay nag-aapuhap ng paumanhin sa kanyang mga kaibigan matapos ang kanilang pag-aaway.

17. Maraming bayani ang nag-ambag ng kanilang talino at kaalaman upang mapabuti ang kalagayan ng bayan.

18. Tinig iyon ng kanyang ina.

19. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

20. Players move the ball by kicking it and passing it to teammates.

21. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

22. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

23. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

24. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

25. Andrew Johnson, the seventeenth president of the United States, served from 1865 to 1869 and oversaw the Reconstruction period following the Civil War.

26. Les travailleurs doivent se conformer aux normes de sécurité sur le lieu de travail.

27. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

28. Las escuelas pueden ser públicas o privadas, coeducacionales o exclusivas para hombres o mujeres.

29. Mahilig siyang kumuha ng litrato sa oras ng takipsilim.

30. Mabilis ang takbo ng pelikula.

31. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

32. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

33. Ang carbon dioxide ay ina-absorve ng mga puno.

34. El movimiento del baile contemporáneo tiene una elegancia sublime que conmueve al espectador.

35. Ito ba ang papunta sa simbahan?

36. My name's Eya. Nice to meet you.

37. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

38. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

39. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

40. Anong tara na?! Hindi pa tapos ang palabas.

41. Natuwa ang mga bata habang pinapanood ang lumilipad na saranggola.

42. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

43. La santé est un état de bien-être physique, mental et social complet.

44. I have a craving for a piece of cake with a cup of coffee.

45. Mababa ang tingin niya sa sarili kahit marami siyang kakayahan.

46. Ano ang kulay ng mga prutas?

47. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

48. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

49. International cooperation is necessary for addressing global environmental challenges, such as climate change.

50. Budgeting, saving, and investing are important aspects of money management.

Recent Searches

mawalaexecutiveumigtadwasteiilanhubad-barotmicahinoglaryngitisanitohimselfprincekassingulangnaglalarohurtigeretrentamaibahvordanmagkahawakpumuntakaramiwednesdayaleslaganaptutusinipipilitdingdinghowevernagkakakaininhalesilangaudio-visuallydatapinalutopulisharapumikotlatestenviaryeahnagtuturomanilanagpakilalahudyatnatatanawkasalananbiologimakamitexhaustioncontinuesisusuotmahawaanpagdukwangmagkakaroonharapansumasakaygaanopagkainiskapitbahayumakyatcapitalistbopolsinagawtaingajocelynelectionsnilinisdullilanwifiayusinkumukulonamingkumainenergy-coalposporonakakapasokjoshnangahasmamayabilerpangetaksiyonkaniyanakakamanghatelevisionbackkalalarouwakmagpapigilkendimediadilagmakalingkalikasanartistlastingtransmitidasmaghahatiddyipninakakagalahulinakakaeuphoricpshhalamangpasukanpanaspalolotanongknow-howwhilesumuotpinakamasayaterminokasiagostogayunmanibigaydifferentlandosynligesugatfuryninyongwikamangehapagitinuroresumenpiermabatongimbesmagkasamayumuyukosentimosbagamatkinabukasankumananprogramming,naiinggitibinalitangnaulinigannaantigmensajesumiwasvideomissionagwadornakangisinggumantibusiness:telangkinikitaestasyonpinagtagpopicturessubject,ipinatawagfollowingnaabutannagsmileikinakagalitpapaanoumulanbihasapalakakampeonjingjingnakainomeksempelamongpiecestransitsiksikaniikutanbecamehelenahanapinanabulalasamerikatabasmagpasalamathinatidpakibigyanconclusion,katabingnagyayangnilayuanadangproporcionarexigentearbejderhistoriapagkuwanamataynahulaanpalasyo