Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "culprit"

1. The authorities were determined to find the culprit responsible for the environmental damage.

2. The authorities were stumped as to who the culprit could be in the unsolved case.

3. The company suffered from the actions of a culprit who leaked confidential information.

4. The company's losses were due to the actions of a culprit who had been stealing supplies.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The culprit responsible for the car accident was found to be driving under the influence.

11. The culprit who stole the purse was caught on camera and identified by the victim.

12. The detectives were investigating the crime scene to identify the culprit.

13. The DNA evidence led to the arrest of the culprit in the murder case.

14. The forensic evidence was used to convict the culprit in the arson case.

15. The guilty verdict was handed down to the culprit in the embezzlement trial.

16. The police were searching for the culprit behind the rash of robberies in the area.

17. The police were trying to determine the culprit behind the burglary.

18. The victim was able to identify the culprit who had been harassing them for months.

19. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

20. The victim's testimony helped to identify the culprit in the assault case.

Random Sentences

1. Mahina ang signal sa kanilang lugar, samakatuwid, nahirapan siyang makipag-usap sa telepono.

2. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

3. Ano ang ginawa ni Tess noong Marso?

4. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

5. Los niños a menudo disfrutan creando arte como una actividad educativa y divertida.

6. Naghihinagpis si Maria nang malaman niyang hindi na niya makakasama ang kanyang pinakamamahal na aso.

7. Repeated frustration can lead to feelings of hopelessness or helplessness.

8. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

9. Magaling maglaro ng chess si Joseph.

10. Ano ho ba ang itsura ng gusali?

11. nakita niya ang naghuhumindig na anyo ni Ogor.

12. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

13. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

14. Mahal na mahal kita.. wag mo muna akong iwanan, please.

15.

16. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

17. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

18. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

19. She watched a series of documentaries about the history of ancient civilizations.

20. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

21. They have been creating art together for hours.

22. Paano mo pinalambot ang giniling na karne?

23. Naku, ang taas pala ng temparatura ko.

24. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

25. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

26. Some limitations can be temporary, while others may be permanent.

27. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

28. Napangiti ako bigla. Yun lang ba yung problema niya?

29. Sa kaibuturan ng kanyang kaluluwa, alam niyang tama ang kanyang mga desisyon.

30. Las noticias en línea pueden ser actualizadas en tiempo real.

31. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

32. Ano ang kulay ng mga prutas?

33. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

34. She draws pictures in her notebook.

35. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

36. Eh? Katulad ko? Ano ba ang isang tulad ko?

37. Det kan være en udfordrende tid at blive voksen og kvinde.

38. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

39. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

40. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

41. The beauty store has a variety of skincare products, from cleansers to moisturizers.

42. Nag-usap kami kamakalawa ng tanghali.

43. Ibinabaon ng magnanakaw ang kanyang ninakaw na yaman sa ilalim ng puno.

44. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

45. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

46. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

47. Maingat niyang sinalansan ang mga tuyong kahoy sa ilalim ng kanilang bahay upang huwag magising ang kaniyang mga magulang.

48. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

49. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

50. Siniyasat ni Sangkalan at ng mga tao ang puno.

Recent Searches

parehasculpritmelissakantahanapoymarteseducationmalamangnogensindenapatinginvedvarendekayabanganpartymagdatinanggapsigesuccessblazinglamanhehemakikitareducedbook:abeneoverallseekerbjacelunesjuicepinagtagpoelenaplayeddatibillcornerssamurichoutpostnaupokotsenguugud-ugodlorenafuncionarpressbosesincreasinglypopulationpromotingbumabahahinanapinirapannakatuoncoulddiretsahangnahawakannagkasunognagdarasalcardfilipinaranaysorpresanagplaymaratingmitigateexistinaapinapilinghumalothoughtscontinuednakatayobaduyikinalulungkotkanyacreatingnasaanbakachoiceshadesmailapbestfriendmovinggeneratehatingseensteermaingatlimitabsoncebartinangkamahuhusayimpitibigiossangkapnakufitnesscompositoresnakapagreklamospiritualpagsusulitmagkapatidsiyangprogramminglinepasalamatansalitangkasalukuyanlumitawteamlilypinakamahalagangmagkipagtagisanyakapminutostudykayaasiatickumapitseveralkukuhaseeknagtatanimbarrerasadverselyadicionalesnakakatulonghetonagkakakainkadaratingmaskaranakukuliliindustrykahirapanniyaabutanpaycarriesibinigayuniqueconsiderdatamusmoslipadmasayahintig-bebentebrideikinatatakotagilityshareautomatisknakatanggappleasesumuwaytinawananagricultoreshabitspulang-pulapagkakalutopinagkiskismanlalakbaymakikipaglarovideos,pinakamagalingnakaramdamnagsisipag-uwianpinag-aaralanpinagbigyanhimihiyawhampaslupakalayuanpinaghatidannakikiaisasabadnaghuhumindignakatalungkoflyvemaskinerinventionpagkuwanmaglaroinvestpawiinnakauwinovelleskuwadernomagtataaspagdudugotravelnamungainismagta-trabahobulalasnakangisisanggolbairdunidoselect