Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "culprit"

1. The authorities were determined to find the culprit responsible for the environmental damage.

2. The authorities were stumped as to who the culprit could be in the unsolved case.

3. The company suffered from the actions of a culprit who leaked confidential information.

4. The company's losses were due to the actions of a culprit who had been stealing supplies.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The culprit responsible for the car accident was found to be driving under the influence.

11. The culprit who stole the purse was caught on camera and identified by the victim.

12. The detectives were investigating the crime scene to identify the culprit.

13. The DNA evidence led to the arrest of the culprit in the murder case.

14. The forensic evidence was used to convict the culprit in the arson case.

15. The guilty verdict was handed down to the culprit in the embezzlement trial.

16. The police were searching for the culprit behind the rash of robberies in the area.

17. The police were trying to determine the culprit behind the burglary.

18. The victim was able to identify the culprit who had been harassing them for months.

19. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

20. The victim's testimony helped to identify the culprit in the assault case.

Random Sentences

1. Natuwa ang mga bata habang pinapanood ang lumilipad na saranggola.

2. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

3. The bag of groceries was too hefty for the elderly woman to carry on her own.

4. Ano ang pangalan ng babaeng buntis?

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Excuse me lang, anong mga kulay ang mayroon?

7. Ese comportamiento está llamando la atención.

8. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

9. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

10. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

11. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

12. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

13. Pedro! Ano ang hinihintay mo?

14. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

15. El invierno se caracteriza por temperaturas frías y, a menudo, por nevadas.

16. Hinugot niya ang kanyang bag sa ilalim ng mesa.

17. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

18. Till the sun is in the sky.

19. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

20. Commuters are advised to check the traffic update before leaving their homes.

21. Tangka na niyang pagbubuhatan ng kamay ang matanda nang biglang lumiwag ang damit ng matanda at nagbago ang kanyang anyo.

22. Nasa ilalim ng mesa ang payong.

23. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

24. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

25. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

26. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

27. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

28. Red horse? Ikaw? nagtatakang tanong ni Genna.

29. Hindi ka ba napaplastikan sa sarili mo, tol?

30. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

31. Wala kang pakelam! O sige its my turn na!

32. Let's not make this into a big deal - it's just a storm in a teacup.

33. The United States has a system of separation of powers

34. She is not playing the guitar this afternoon.

35. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

36. Naglalakad siya sa parke araw-araw.

37. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

38. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

39. Gamitin ang pangungusap ayon sa sinabi ng guro.

40. Huh? Anong wala pa? nagtatakang tanong ko.

41. Hendes måde at tænke på er fascinerende og udfordrer mine egne tanker. (Her way of thinking is fascinating and challenges my own thoughts.)

42. Hindi niya gustong maging nag-iisa sa buhay.

43. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

44. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

45. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

46. The stock market can provide opportunities for diversifying investment portfolios.

47.

48. Hindi siya makatulog dahil sa kati ng bungang-araw.

49. Aray! nagcurve ball sya sa sakit sa sahig.

50. Nag-aaral siya sa Seasite bawat araw.

Recent Searches

culpritatensyonpulongbumangontuktokano-anoafterbigotegardenlenguajeambagpresentawealthmisusedsubjectjoepagodpetsakagubatanresponsibleipagtimplabadideainitdoesmonitorwhymamahalinprocesssakyanrinkaragatankarangalangeologi,nagpanggappasanhmmmbaoanongtinanggalpalakababaengbayanginagawapunong-kahoymahabagustobaranggaytamaantuyokamalayanginugunitapumasoknakinigpinansinililibreayawnagdarasalalamkumakalansingginawamoneyhanggangmakawalasourcesnarinigpornakikitaamoykumainnakapikittungkoltopickalawakankampeonmangahaspakikipagtagpotaga-hiroshimabecameiniinomkitang-kitamusicenchantedsimulastorefresconanditoubobinasadulotcaraballofiverrtumaposkumaentapaterrors,komunikasyonmagbasanakaangatwerehapag-kainankinainbingimalakibutpagpapasanlending:isipankumakainkauna-unahangmoodkungtemparaturatreatssumisilipipinaalamandrewinternamanytinahakgumuhitginangnaabotkambinglangpagbabagong-anyokamalianmagdamaganhoweverhumigakanyanangangakokulaypaslitbirobangtaposeffort,ricotomarhaltsinocheckskargangmainitbinabatipatakbongumiyakheartbreakinapinakainkrushiliggayundinbuhayicekunintotoofullpasokprospersang-ayonnakapaligidkayatermkatulongganyanngangallowingrollednakataposdiscouragednagdadasalrolanddemmuntingoverallkinalakihansocialkasaganaanbagamatpigilannearmayabongtumambadmunapamangkinledmakapasamayakapnagwalisedukasyonngayonnag-oorasyonkaraokepamburacultivatederlindakapamilyachess