Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "culprit"

1. The authorities were determined to find the culprit responsible for the environmental damage.

2. The authorities were stumped as to who the culprit could be in the unsolved case.

3. The company suffered from the actions of a culprit who leaked confidential information.

4. The company's losses were due to the actions of a culprit who had been stealing supplies.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The culprit responsible for the car accident was found to be driving under the influence.

11. The culprit who stole the purse was caught on camera and identified by the victim.

12. The detectives were investigating the crime scene to identify the culprit.

13. The DNA evidence led to the arrest of the culprit in the murder case.

14. The forensic evidence was used to convict the culprit in the arson case.

15. The guilty verdict was handed down to the culprit in the embezzlement trial.

16. The police were searching for the culprit behind the rash of robberies in the area.

17. The police were trying to determine the culprit behind the burglary.

18. The victim was able to identify the culprit who had been harassing them for months.

19. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

20. The victim's testimony helped to identify the culprit in the assault case.

Random Sentences

1. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

2. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

3. Emphasis is an important component of artistic expression, such as in poetry and music.

4. Kumirot ang dibdib ko sa naisip.

5. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

6. Sa pagpaplano ng kasal, kailangan isaalang-alang ang oras ng seremonya upang hindi maabala ang mga bisita.

7. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

8.

9. At sa sobrang gulat di ko napansin.

10. Kung may gusot, may lulutang na buhok.

11. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

12. Puwede ba sumakay ng taksi doon?

13. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

14. En invierno, se puede disfrutar de hermosos paisajes cubiertos de nieve.

15. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

16. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

17. Twinkle, twinkle, little star.

18. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

19. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

20. Masayang kasayaw ng mga Kuneho ang mga Usa, ng mga Elepante ang mga Tamaraw, ng Zebra ang Tsonggo.

21. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

22. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

23. Puwede ka ba sa Miyerkoles ng umaga?

24. Sa gitna ng pagkabigo, hindi maiwasan ang paglabas ng malalim na himutok.

25. Eating healthy is an important way to take care of your body and improve your quality of life.

26. Nagbigayan kami ng mga regalo noong Pasko.

27. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

28. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

29. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

30. The cutting of the wedding cake is a traditional part of the reception.

31. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

32. Ang kabanata ay nagtapos sa isang maigting na eksena o cliffhanger, na nagtulak sa mga mambabasa na magpatuloy sa pagbasa.

33. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

34. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

35. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

36. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

37. The patient's family history of leukemia increased their risk of developing the disease.

38. Cryptocurrency has faced regulatory challenges in many countries.

39. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

40. The officer issued a traffic ticket for speeding.

41. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

42. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

43. Hiram lamang natin ang ating buhay sa Diyos.

44. The bookshelf was filled with hefty tomes on a wide range of subjects.

45. Isang mahigpit na tunggalian ang naganap sa gitna ng kabanata, na nagbigay daan sa pagbabago ng landasin ng kuwento.

46. There were a lot of people at the concert last night.

47. Banyak orang Indonesia yang merasa lebih tenang dan damai setelah melakukan doa.

48. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

49. Magkano ito?

50. Gusto kong ibigay ang aking buong atensyon sa aking nililigawan upang malaman niya na tunay kong mahal siya.

Recent Searches

dasalculpritphilosophicalthroatnararapatantokahasmatikmanhastasellingkutodpasigawdalagangbililaronghundreddefinitivocharismaticltoproductskasakitnasannaglokokadaratingpanayvehiclessalarininaboracaynunoparopalagimayabangbingbinggranadacomienzanbasahankwebangmagpuntasinipangmesangkatabingrabefeedback,dollycommunitydaddynaglalambingestardelegenerationerkingideyaprovidelosdyanroselabanunderholderchecksconditioningmovingpinilingumilingplatformsmapapacigaretterolledcomunesyearmagkanoaddingmakapilingdumaramidatainfinityvantechnologiesdraft,facultyrelievedestablishedeffectfeltflashmagpapalitmarahaskayang-kayangobra-maestrananghihinamadrobinhoodpayatre-revieweyethroughoutmasasabiassociationpinagpapaalalahananmagturolalabasmayamangkinikilalangnananalopookpakakasalantagumpaykumakalansingmahiwaganagniningningpagkaimpaktomakatulogdivideslarawanumayossaan-saannilangmabutihumampaskumembut-kembotnapakatagalikinakagalitnaglalakadnagandahansasayawintinaasankwenta-kwentat-shirtnagtuturonananaginipmakauuwipang-araw-arawgirlfriendmasayahinbloggers,nakahigangerhvervslivetmiyerkolesculturalnapaiyakunahinmagagamitmagtigilmagpahabadesisyonanpanindaumagawnatuwaaga-agatungawaktibistapakakatandaannabighanitv-showsmasasayamalulungkotmangyaricualquiervaccinespaninigaspinangalanannagdalatutusinnglalabanatakotmisyunerongnagpasankaninaginahiramisinalaysaytinikmanpaalamdurantenilaossugatangnakauslingmahahawaumagang1970snewspahahanapvelfungerendebibigyantatlosayatanawunconventionalkinalimutanmagdaanmariearegladopaketemagsaingenglandanonggagambalangkayniyogginangtibig