Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "culprit"

1. The authorities were determined to find the culprit responsible for the environmental damage.

2. The authorities were stumped as to who the culprit could be in the unsolved case.

3. The company suffered from the actions of a culprit who leaked confidential information.

4. The company's losses were due to the actions of a culprit who had been stealing supplies.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The culprit responsible for the car accident was found to be driving under the influence.

11. The culprit who stole the purse was caught on camera and identified by the victim.

12. The detectives were investigating the crime scene to identify the culprit.

13. The DNA evidence led to the arrest of the culprit in the murder case.

14. The forensic evidence was used to convict the culprit in the arson case.

15. The guilty verdict was handed down to the culprit in the embezzlement trial.

16. The police were searching for the culprit behind the rash of robberies in the area.

17. The police were trying to determine the culprit behind the burglary.

18. The victim was able to identify the culprit who had been harassing them for months.

19. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

20. The victim's testimony helped to identify the culprit in the assault case.

Random Sentences

1.

2. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

3. Nilimas ang kanilang kabuhayan at sapilitang dinala sa tabing dagat ang kadalagahang napili.

4. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

5. Emphasis is the act of placing greater importance or focus on something.

6. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

7. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

8. Sinuman sa kaharian ay walang makapagbigay ng lunas.

9. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

10. The field of entertainment has also been greatly impacted by technology

11. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

12. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

13. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

14. Limitations can be a source of motivation to push oneself to achieve more.

15. Fathers can also play an important role in teaching life skills and values to their children.

16. Okay.. sige.. intyain ko na lang tawag niya.. thanks..

17. Nagpasama ang matanda sa bahay-bahay.

18. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

19. Ang daming adik sa aming lugar.

20. Jagiya? hinde parin siya umiimik, Ya Kenji.

21. Television also plays an important role in politics

22. Teka anong ginagawa niyo dito? 9 na ha!

23. Smoking is a leading cause of preventable death worldwide.

24. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

25. Puwede ho ba akong kumain ng baka at baboy?

26. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

27. La realidad es a menudo más compleja de lo que parece.

28. Paano ho pumunta sa Manila Hotel?

29. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

30. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

31. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

32. The internet is full of fashion blogs. They're a dime a dozen.

33. "Walang madali sa mundo, lahat ay pinaghihirapan," ani ng aking lolo.

34. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

35. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

36. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

37. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

38. Ang mga magsasaka ay nagtatanim ng palay.

39. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

40. Taos puso silang humingi ng tawad.

41. Ang bagal ng internet sa India.

42. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

43. Pumunta ka dito para magkita tayo.

44. Make sure to keep track of your sources so that you can properly cite them in your book

45. Omelettes are a popular choice for those following a low-carb or high-protein diet.

46. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

47. Bumisita ako sa lola ko noong Mayo.

48. I usually like to tell a joke to break the ice at the beginning of a presentation.

49. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

50. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

Recent Searches

culprittaga-ochandomaximizingrolandpagtitiponkatabingnanggigimalmalmaidnagtagisanattention1973uniquepinabinibilangforskel,nasahodhallnegativeboardlayuninmamuhaynotganangmagkipagtagisanutak-biyastudentcallingdentistawalongfacebookaminmalabomakatixixbethmaipagpatuloykaniyapakistanmag-asawakumalasmuchosfirstmilyonghongtabihankulay-lumotpinabulaankaramibasahindinalawmagagawabumalikmisteryosongpatakbonglospresenceangkinghablabamagbakasyonogsåanothersiyangnapaginalalayansumangibalikpangbedsidemadamiwhymagsisinejolibeemakakatalodollykambingnatingnatitiyakwednesdaylasingpaslittelecomunicacionespag-aaralcontrolledjanusedekorasyonmatutulogjacky---alokma-buhaydivisionreplacednotebookmabilisMahirappermitennilangbukodlalakaddownaktibistaalmusalinvesting:nakinigbulaklaklangmangyariduwenderelymatamandiaperbitawandisenyobuwishinabisongsnapakahababinatomayumingmalinapakachristmaspananakoptanimipagtanggolkabighabighaniorasina-absorvemakingnapapikitadvertisingmoderneboteyakapinbayadsumpahanapbuhayumikotsanggolthinkpakilagayginamitnagre-reviewleadersutilizarhoneymoonersipagtimplakikitalolaemocioneskaibangskyresearch:marketplaceslightsdiinaustraliamedya-agwawalangmayamangmaitimlagistyleexampleburdennakakapasoktenmagkakaroonroseomelettewristtulunganboksinglinggo-linggosallypaninigasadvancementnagulatnadadamaydivisoriapapayamag-amaboracaypicturebankkinakailangangmaghahabingumiwismokeparusahankumakantatulalaernanpinapasayamapalampasdullgayunmannawawaladesde