Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "governors"

1. The United States also has a system of governors, who are elected to lead each individual state

Random Sentences

1. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

2. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

3. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

4. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

5. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

6. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

7. Maglalaba muna ako bago magpunta sa galaan.

8. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

9. Ayaw ng nanay kong magtrabaho sa Linggo.

10. Cancer can impact not only the individual but also their families and caregivers.

11. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

12. Ipaghanda mo si Lina ng Maghanda ka ng damit

13. They are not shopping at the mall right now.

14. Mathematics is the study of numbers, quantities, and shapes.

15. The heavy traffic on the highway delayed my trip by an hour.

16. Sa gitna ng kaguluhan, hindi niya mapigilang maging tulala.

17.

18. Ang pagsama sa kalikasan ay nagdudulot ng isang matiwasay na kalooban.

19. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

20. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

21. Marami siyang kaibigan dahil palangiti siya.

22. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

23. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

24. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

25. Det er vigtigt at have en positiv indstilling og tro på sig selv, når man bliver kvinde.

26. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

27. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

28. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

29. Emphasis is often used in advertising and marketing to draw attention to products or services.

30. Ahh nasa shower kasi si Maico sinagot ko na baka impor...

31. We have been waiting for the train for an hour.

32. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

33. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

34. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

35. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

36. La tos puede ser un síntoma de COVID-19.

37. The invention of the telephone and the internet has revolutionized the way people communicate with each other

38. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

39. Pede bang itanong kung anong oras na?

40. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

41. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

42. Hindi niya napigilan ang pagdila sa kanyang labi nang naglalaway siya sa pagkaing inihain sa kanya.

43. Mabuti pa makatayo na at makapaghilamos na.

44. Salamat at hindi siya nawala.

45. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

46. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

47. The Great Wall of China is an impressive wonder of engineering and history.

48. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

49. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

50. Madalas lasing si itay.

Recent Searches

anumangnatitiyaknewsgovernorsgumuhitmaglarofundrisepalakolnakangisingpaidnamuhaykamalianoperativostalinobefolkningencynthiamatandangsteamshipspinipilitbahagyahabitssukatinsumalakayengkantadamalilimutankanilatataaslinajulietsasapakinipinansasahogipinambilipulgadahoteldeterminasyonparurusahanadvancebinibilangandoyenglandmaalwangkarganglupaintayokakayanangmapahamakoutlineairconhugisutilizarkinsemalamangarguecarmenmagigitinglipadiskedyuledukasyonmatangmisuseddagatingsobrapasyaoueisugabriefcardnatanggapbarnes11pmresortadvancesmaluwangsilbinglossmarioramdambilaotsemournedresumencomplicatedchecksdumilatpaaprofessionalsedentaryboseslorenaideaakindemocraticvotesmapuputiprogramatypeshellointerviewingcreateaddinggeneratedtiyaparatingaggressiontechnologicalrepresentedtumatawadmangyaripaglulutoluhaaparadorlikuraninternetlibanganlikelyspaghettibatang-batakamakalawabalik-tanawsangkapkalayuanpwedemagbantaynauliniganpalancatigrelabastumahanjennycomputeretuminginproductividadtumalimnagsmilekwebangkinuhaliligawanmarunongmabibingiindiapitomainstreamcomplex1787namungadoonstoplightlimitfourhapdilineexpertiostransitformagenerateglobalmalapadkadalagahangspiritualnagliliyabmarketplacesnagtatampopinakamaartengdi-kawasapinag-aaralannagmistulangkabundukancrucialselebrasyonnakatapatnapaiyaknagawangtreatsfollowing,investingtumulongdiyantaosiniindapamagatpagtatakanaglokohantinahaknasagutanmagtigilmagbibiladthanksgivingpagtatanongkinauupuanmatapobrengpinagsanglaankapangyarihanmagasawangpakanta-kantangnapapatungoisinulatvirksomhederpinahalata