Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "lily"

1. Baro't saya ang isusuot ni Lily.

2. Magsusuot si Lily ng baro't saya.

Random Sentences

1. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

2. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

3. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

4. Ano naman ang gagawin mo sa inyong hardin? wika ng binata

5. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

6. Les employeurs recherchent des travailleurs fiables et ponctuels.

7. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

8. Ilan ang mga puno sa bakuran ninyo?

9. Kaano-ano mo si Juan Dela Cruz?

10. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

11. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

12. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

13. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

14. Kailangan mong malaman kung sino ang mga taong bukas palad sa iyo upang hindi ka masaktan.

15. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

16. Hindi dapat sumuko agad kapag mailap ang posibilidad ng tagumpay.

17. Magkaiba ang disenyo ng sapatos

18. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

19. Ano ang ikinagalit ng mga katutubo?

20. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

21. Let's just hope na magwork out itong idea ni Memo.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. Kapag dapit-hapon, masarap kumain ng merienda habang nagmamasid sa sunset.

24. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

25. Después de desayunar, salgo a correr en el parque.

26. Hindi niya inaasahan ang biglaang promotion na ibinigay sa kanya ng kanyang boss.

27. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

28. Nagtawanan kaming lahat sa hinirit ni Kenji.

29. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

30. She carefully layered the cake with alternating flavors of chocolate and vanilla.

31. Mathematical formulas and equations are used to express relationships and patterns.

32. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

33. Hindi na sila nasisiyahan sa nagiging asal ng bata.

34. Stay there. si Maico sa awtoritadong tono.

35. Aku rindu padamu. - I miss you.

36. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

37. May nakita ka bang maganda? O kabigha bighani?

38. A couple of minutes were left before the deadline to submit the report.

39. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

40. Nag tinda si Aling Pusing ng isda upang may makain ang kanyang mga anak.

41. Sa likod ng mga tala, kahit sulyap lang, Darna

42. Sinigang ang kinain ko sa restawran.

43. I-google mo na lang ang mga tanong na hindi mo maintindihan.

44. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

45. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

46. En España, la música tiene una rica historia y diversidad

47. Nagbabakasyon ako tuwing Abril.

48. She is not studying right now.

49. Makisuyo po!

50. Ilan ang tao sa silid-aralan?

Recent Searches

lilymalinisbangpamahalaanvideokalanfacultypinakamahabagabeyaripobrengritwalmalagosupilintindahanlabanpag-ibigmayroonhandabagkussinabinakakaalamsarilitableindianakaliliyongdedicationagaw-buhaytwo-partyhapagpinagmamalakisigesangatunaysilaclarakaibigancanadaadventyeheymakikiraanaraypagelimangmediantenatabunantungkolmamulotmiyerkulescalambaalas-tressorkidyaslugartinataluntonkainitanhiramlarawangayundinmanualgagamitinkagyatsumuotpromotingsasakyannagtrabaholibropagdatingpumupurilangkaypakidalhankamandagpakikipaglabankumunotayonsahigcomeampliapagka-diwatakaratulangumagangmulapulisnapapansintelephonekasayawnag-asaranvedpisonaapektuhannakakadalawpersistent,bulsareadingproducerernami-missmataraypadabogmangemalisanmaliligomahawaanmagulayawmagpaliwanagmagkakapatidmaghintaymukahdiseaseslenguajelegendlawayknow-howiosinjuryincreaseimprovementimagingidea:huertohjemhiskisapmatasalamathealthierdilawhdtvmeronevolucionadoestiloselektroniksangkalaneffektivteachdonationsdevicesdesarrollardailycuidado,cryptocurrency:dadalocoaching:systemcareeryoungyou,westvasquesumiyakde-latatumulaktumatawadtumatawatumalimtumagaltuluyantulalatsonggotraditionaltilskrivesofrecenthemthanksgivingthankstennisteknologitaun-taonsumasagotpagsagotstylekongsequesedentarysanaypresentpopularplagasneamovingkungmathhidingmatatalonariningmasasayamarkedmalayongmakikipagsayawhampaslupamakalapitmaibalikmagdaanschoolstiyasolarmagsuotmestmag-galamagpagalingmaghahatidmagbibiladmagbalik