Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "balances"

1. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

Random Sentences

1. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

2. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

3. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

4. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

5. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

6. Elektronik kan være en kilde til underholdning og sjov.

7. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

8. Ha? Anong konek ng gas sa taong nagugutom?

9. Sino ba talaga ang tatay mo?

10. Me duele al tragar. (It hurts when I swallow.)

11. I love you so much.

12. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

13. Humingi siya ng makakain.

14. Duon nakatira ang isang matandang babae at ang kanyang apo, isang binatilyo.

15. Nakatira ako sa San Juan Village.

16. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

17. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

18. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

19. Ang buhay ay isang mumunting paraiso lamang.

20. Yari sa kahoy ang sahig ng bahay ko.

21. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

22. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

23. Isang linggo nang makati ho ang balat ko.

24. In the years following his death, Presley's legacy has continued to grow

25. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

26. The management of money is an important skill that can impact a person's financial well-being.

27. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

28. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

29. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Yung totoo? Bipolar ba itong nanay ni Maico?

32. Stay there. si Maico sa awtoritadong tono.

33. Sus gritos están llamando la atención de todos.

34. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

35. The concert raised funds for charitable causes, including education and healthcare.

36. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

37. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

38. Ang utang ay maaaring magdulot ng stress at anxiety kung hindi ito maayos na hinaharap.

39. The level of sweetness can vary in different types of sugar and sweeteners.

40. Mahusay talaga gumawa ng pelikula ang mga korean.

41. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

42. Kayo din po ba ang nagpapakain sa kanya?

43. Ngumiti siya at lumapit kay Maico.

44. Mahilig sya manood ng mga tutorials sa youtube.

45. Ilan po ang lalaking pumasok sa restawan?

46. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

47. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

48. Don't give up - just hang in there a little longer.

49. The hiking trail offers absolutely breathtaking views of the mountains.

50. En España, el cultivo de la vid es muy importante para la producción de vino.

Recent Searches

associationbalancespagkakatumbaterminobangkabingidalawaadvancedbakebubonghalu-haloaregladosyangmagbabakasyontelefonermaliliitjustbayawakcultivationmasasamang-loobpatuloynapabuntong-hiningalapisbakuranfulfillmentnaglabatanawabainintayenerothankpusalaybrariingatantungawprobablementebusbeseskaniyaentertainmentomfattendeenergytinapaymatangumpaybantulotbunutanagilanatuloybanlagpinagbubuksanpinagpatuloynagpapaigibressourcernenapakamisteryosoginugunitaadvertising,kinamumuhiankategori,pusosingerikatlongbintanagubatmagpakaramipropesorpagdiriwangsementeryoindustriyasugatangiyamotpatakbongcombatirlas,starsnapanoodaanhintumahimikminu-minutopronountobaccomakahirampagkuwapresidentialnanghihinakaloobangbakataxikuripotmahuhulicompaniesmaghihintaytog,mahabollumutangpabulongnagsinenanunuritindanaglahowatawatnakahugengkantadangnagmistulangnagcurveculturesunud-sunurantatagalencuestaspamilyanaiyaktvskinagagalakincludeipinalutobetweenberkeleyyeahskillandysamasteeritlogregularmentestartvegaslagaslasisubogrocerytraditionalnanigassumasakaymaluwagginoongnahantadkanayangwakasrenatodissepangkatbagkusiniintaysinenogensinderestawranself-defensehimayinaniyascottishhmmmmverdencomputere,choiipantalopbusybilivistelijenag-replywariguropeer-to-peersinapakcupidlayasparty00ammaisbranchsaidpinatidblazingnapatingalapalapitstevefatginisingtryghedvideokumaripascebureservedbumahaulamhumanodisappointchecksstylesmakilingpromotingidea:callbeginningheinutrientesauditmapakaligooddentistakangkongsedentaryexpectations