Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "probinsya"

1. Ang mga magsasaka sa aming probinsya ay pinagsisikapan na mapanatili ang masaganang ani sa kanilang mga bukirin.

2. Ano namang inasikaso mo sa probinsya?

3. Dumating ang bus mula sa probinsya sa hatinggabi.

4. Sa aking probinsya, tawag sa pulotgata ay "latik".

5. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

6. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

7. Sa probinsya, maraming tao ang naglalaba sa ilog o sa bukal.

8. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

9. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

Random Sentences

1. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

2. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

3. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

4. Mathematics has its own set of symbols and notations that make it easier to express complex concepts.

5. Ano ang kinakain niya sa tanghalian?

6. He has been to Paris three times.

7. He's always the first one in the office because he believes in the early bird gets the worm.

8. May kanya-kanyang bayani ang bawat panahon.

9. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

10. Microscopes are also used in materials science and engineering to study the microstructure of materials.

11. Chumochos ka! Iba na pag inlove nageenglish na!

12. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

13. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

14. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

15. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

16. Isa sa tatlong magagandang magkakapatid si Psyche.

17. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

18. El que busca, encuentra.

19. Ano ang isinusuot ng mga estudyante?

20. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

21. Ano ho ba ang itsura ng gusali?

22. Hindi na siya pumasok para maabutan lang ang dalaga, ngunit, sa kasamaang palad hindi niya ito inabutan.

23. The host introduced us to his wife, a beautiful lady with a charming personality.

24. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

25. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

26. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

27. Emphasis can be used to highlight a person's strengths and abilities.

28. Ilang taon ka tumira sa Saudi Arabia?

29. Napapasabay din sa pagimbay ang mahagway na Kawayan kasama ang Pagong na nagbababa at nagtataas ng bahay-bahayan.

30. I don't want to beat around the bush. I need to know the truth.

31. Seperti katak dalam tempurung.

32. Hindi dapat natin tolerahan ang anumang uri ng paglapastangan dahil ito ay sumisira sa mga pundasyon ng pagkakaisa at paggalang sa isa't isa.

33. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

34. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

35. Saan niya pinagawa ang postcard?

36. Nationalism has been used to justify imperialism and expansionism.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Pagputi ng uwak, pag-itim ng tagak.

39. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

40. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

41. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

42. En España, el cultivo de la vid es muy importante para la producción de vino.

43. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

44. Alam ko ang kabutihan ng iyong kalooban.

45. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

46. Sadyang nagulat ako sa kanyang biglaang pagbisita.

47. Sa dakong huli, nakita ko ang aking kaibigan na umiiyak sa sulok ng classroom.

48. Ito ang barangay na pinamumunuan ni Datu Diliwariw.

49. Stress can be a contributing factor to high blood pressure and should be managed effectively.

50. We have a lot of work to do before the deadline.

Recent Searches

probinsyamakitasiglaspeechesmayroonpinagkasundopaskokaniyanagsimulapangitkatagapagkaindumagundongattackfanshahahalegislationpasaherodosenangipagbilimetodeconductnegosyolivetuwangbulalasmisusednag-aalaypulubimagsayangbasanatutulognakakatawasasabihinmalamangmagkasinggandapalengkebuwayakaykayaberegningermadilimnagtatakadatapwatmabibingipotaenaparisukathumalosalaminteknologimaghapongpauwipaamaliksikapataganbuhokbyggethmmmmaalwangtatawaganpunong-punomaliitandrewlalakadpamilihang-bayanlagaslasmarketplacesfourpinaladmahinangipinculpritmagpa-paskobinibinichumochosmagingpagmasdankumalatkalabawadverselybasketballkanilakitabinasadoonmagpa-ospitalengkantadanagmamadalitagaakinmamalascongratswhilepwedengdurianpasankumidlatsimplengkwenta-kwentabringkolehiyobitbitnawawalaseryosongmatandanapilicommander-in-chiefbihasamababangisknowspamilyatablemaghaponpundidokarwahengangheliyannahintakutansolidifybagamakalayaanlumampasnyamasipaglabanartificialnaglalabamanatilisang-ayoniba-ibangsabermagandapleasenatandaanpang-araw-arawbulaklakgirlbayarancallunawarinaliligomaingataywanmabihisanhinahanapbabaengpalaisipansinulidnumerosasrebolusyonmedya-agwamarketingkasingprobablementepaghahanapbumagsakneronilapitanmagkanobukaskaugnayansagabalmiyerkulespatiiskedyulpuedesnaghihinagpisnapapansinnagliliwanagmatchingnaibibigayutilizamaglinissiyang-siyamalihismaglalaronatinagdinalagooglegawanakitulogtinanggappunong-kahoymahigpitkahaponpadabogpalibhasapaladnangahasnagdiretsosawsawanviewspagkamanghapahahanapzoomagawalubospagkataopanginoon