Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "inabutan"

1. Hindi na siya pumasok para maabutan lang ang dalaga, ngunit, sa kasamaang palad hindi niya ito inabutan.

Random Sentences

1. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

2. La historia del arte abarca miles de años y se extiende por todo el mundo.

3. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

4. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

5. Hindi pa rin siya umaalis sa kinauupuang balde.

6. Hoy en día, el internet es una parte integral de la vida cotidiana.

7. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

8. The phone rang late at night, and therefore she was hesitant to answer it.

9. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

10.

11. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

12. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. Microscopes require careful handling and maintenance to ensure accurate results.

14. Ayos lang. Basta alam kong safe kang nakauwi.

15. Il faut que j'aille faire des courses ce soir.

16. Napa wow na lang ako ng makita ko ang kanyang suot na bestida.

17. Ang paglapastangan sa ating kasaysayan at mga bayaning nagbuwis ng buhay ay isang pagsasawalang-kibo sa kanilang sakripisyo.

18. The detectives were investigating the crime scene to identify the culprit.

19. Nang maglalabing anim na taon na si Rabona ay may nakita siyang isang pusa sa kagubatan.

20. Nakakatawa? mataray na tanong ko sa kanya.

21. Sakay na! Saan ka pa pupunta?!!

22. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

23. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

24. The clothing store has a variety of styles available, from casual to formal.

25. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

26. Limitations can be overcome through perseverance, determination, and resourcefulness.

27. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

28. They are building a sandcastle on the beach.

29. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

30. Kumaliwa ka papuntang Masaya Street.

31. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

32. Have they finished the renovation of the house?

33. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

34. Kung walang tiyaga, walang nilaga.

35. Nagagandahan ako kay Anna.

36. Gusto ko lumabas pero malakas pa ang ulan.

37. Si Dr. John ay isang doktor sa kanilang baryo.

38. The laptop's hefty price tag reflected its powerful specifications and high-end features.

39. Do something at the drop of a hat

40. Pakibigay sa akin ang listahan ng mga paalala bago ako maglakbay.

41. Parehas na ayaw magbigayan ang dalawang pangkat at pinipilit na sila ang mas nararapat kaysa sa isa.

42. Hindi na maganda ang asal ng bata ayon sa diyosa.

43. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

44. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

45. Les personnes âgées peuvent avoir besoin d'une aide financière pour subvenir à leurs besoins.

46. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

47. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

48. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

49. Coffee shops and cafes have become popular gathering places for people to socialize and work.

50. Pedeng ako na lang magsubo sa sarili ko?

Recent Searches

inabutanpakakatandaandiwatapaglalabaumuwipakakasalancompanieskumampipinalayaskuwentotatanggapinhumalopoorermagkasakitkahitnatitiyaktungonaiinisnagsamamalalakibakanteproducenabiawangbawiantechnologicalsayopiyanotiniklingkaraokekapwanangingisayjeepneypigilannatutulognalangsahigkaniladuwendeabigaelsementocommercialctricaskatibayangteachingslangkayanumankamoteasiamaramotpangakonapasukotatlobayangbahaypapelandresbalatcarolkulotkontingbinangganilolokonangyarieskwelahaneclipxeviolencepalangkindsedsamagtipidlarongadditionally,outlinebeginningsingatansantointerestsanitobinilhanpanovelstandmapahamakmahiwagangsamfundgamotelitepinaladsakinrosateleviewingbairdpropensobasahankwebangrhythmfeelcongresssilaydisyemprepuedemulighedbagkus,lorenapalaginginisprofessionalbumugaresearchtenumiilingaudio-visuallygodhudyatnaistrackipipilittopic,dinluispupuntasarilingfriesbelievedstateartificialstageboybabesedentaryauthorgeneratestandrequiretableuloenterumarawtechnologieslearnpasinghalrawahitpinatirakasitinderabecomesnumerososcrucialaleinaloksundaloilogtumiramatapangsinabicoughingvideos,nakarinigpaghihirapsiniyasatdraft:nanghingipagkaimpaktobeautytumindigferrerligayatiemposakinhinanapdiaperhelpfulhandagulaymatagalbrasoplagaspitumpongkaugnayansinknatalongbuslolaborbulafuncionessumindi2001scalepinangyarihanpagkakatuwaannakaliliyongpagsasalitaanimlandasnahawakannagsasagotmangangahoynaglalakadnagtagisannagliliwanag