Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "makisuyo"

1. Makisuyo po!

Random Sentences

1. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

2. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

3. Aray! Bakit mo ako sinapak! Potaena mo naman!

4. Ilang beses ka nang sumakay ng eroplano?

5. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

6. I finally finished my degree at age 40 - better late than never!

7. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

8. Gracias por su ayuda.

9.

10. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

11. Ang kanyang ama ay isang magaling na albularyo.

12. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

13. Paparami iyon at pumapaligid sa kanya.

14. Left-handed scissors are specially designed for left-handed individuals to ensure comfortable and efficient cutting.

15. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

16. Ano ang ginawa ni Tess noong Marso?

17. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

18. The company lost a lot of money by cutting corners on product quality.

19. A dedicated student is willing to put in the extra hours of studying to excel academically.

20. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

21. Sa gabi, natatanaw ko ang mga bituin na kumikislap sa langit.

22. Sumakay sa jeep ang mga pasahero nang limahan.

23. Ilang kutsaritang asukal ang gusto mo?

24. Napatingin ako sa orasan. 12 na ng madaling araw.

25. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

26. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

27. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

28. We have been waiting for the train for an hour.

29. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

30. ¡Feliz aniversario!

31. The concert last night was absolutely amazing.

32. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

33. Umuwi na ako kasi pagod na ako.

34. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

35. Winning the championship left the team feeling euphoric.

36. Nagpa-photocopy ng report si Kiko.

37. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

38. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

39. ¿Qué fecha es hoy?

40. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

41. Bukas ang biyahe ko papuntang Manila.

42. Ok ka na ba? tumango si Athena, Mabuti naman..

43. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

44. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

45. The little girl dressed up as a pretty lady for Halloween.

46. Si Marian ay isang sikat na artista sa Pilipinas.

47. He is painting a picture.

48. Elle adore les films d'horreur.

49. La prévention est une approche importante pour maintenir une bonne santé et éviter les maladies.

50. Botong boto nga sayo ang mga magulang ko eh.

Recent Searches

makisuyoawardtinapaygigisingkumapitbesespalibhasabuwayainspiredakilanglinakamalayannaghuhukaydiretsobumotoayokodiscoverededucationilawbumabagdailykulayparurusahanjenaedukasyonabrilsantopinatidloanstwitchipatuloytinanggapgamitinindiatresroomnagbungalawsmagdakerbnamredesfialutopeepsinunodmasaganangmalalimtarangkahan,bumugamuliabenepingganlabingprovedaysshowcongratswideofficeipinagbibilinganaminpublishingdidingdaddysumanginuminadventstrengthmainitperaminutemalimitschooldosfacemarkedfarlockdownmovingstandmetodebulakartonpaanomalagosteamshipstrabahoyakapprogrammingsyncgenerabasmallinteligentesincreaserequiresettingthirdbeyondonlypassivejuegospaghaliknaghihirapmagturoleaderspagkaangatmaipapautangpaghaharutanmakuhangpootnilangexamleytemayoconnectingipagbilisoredilimsystematisksaktanphilippineparkipinaalamnag-iisapaglalayagpagkakalutonapatawagnagbakasyonmakikipag-duetonakakapagpatibaymakikipaglarokaano-anonakumbinsinakikini-kinitabatipinagmamalakikaliwangkaklasesquattertubigpangyayarituluyanmaliksienergy-coalnalagutanmagulayawclubsimbahanpagtatanongnagpasanmaghapongpadalascynthiaconvey,sakennamilipitlagingbarrerasparusahanpagkakataonbanyokaloobangnag-uwiganangmagdaraosmasasabidiyaryohawaiisiksikantumikimnagtataere-reviewsiglabastacaracterizamasaholbinentahaniikutancombatirlas,nakarinigduranteiiwasanpinangalananmatulunginmukhalumbaynapasukoanubayanomfattendeadmiredctricaskumaensumpainapologetictasacompositoresnagisingtodas