Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "so-called"

1. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

2. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

3. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

4. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

5. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

6. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

7. My grandma called me to wish me a happy birthday.

8. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

9. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

10. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

2. Omelettes are a popular choice for those following a low-carb or high-protein diet.

3. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

4. Sino-sino ang mga kaklase ni Carmen?

5. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

6. Tumayo siya tapos humarap sa akin.

7. Ang taong nagigipit, sa patalim kumakapit.

8. Hindi pa namin napapag-usapan eh. sagot niya.

9. Inirekomenda ng guro na magbasa kami ng maraming aklat upang mapaunlad ang aming kasanayan sa pagbabasa.

10. Effective use of emphasis can enhance the power and impact of communication.

11. Puno ng hinagpis ang liham na iniwan ni Clara bago siya tuluyang umalis.

12. Einstein was a pacifist and spoke out against war and violence throughout his life.

13. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

14. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

15. He tried to keep it a secret, but eventually he spilled the beans.

16. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

17. Ang pamamaraan ng kasal ay nag-iiba sa iba't ibang kultura at relihiyon.

18. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

19. The chef is cooking in the restaurant kitchen.

20. Sariwa pa ang nangyaring pakikipagbabag niya kay Ogor, naiisip ni Impen habang tinatalunton niya ang mabatong daan patungo sa gripo.

21. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

22. Nagulat ako sa kanyang biglaang pagbisita, ngunit ito ay nagdulot ng kasiyahan sa aming pamilya.

23. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

24. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

25. You can always revise and edit later

26. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

27. He blew out the candles on his birthday cake and made a wish.

28. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

29. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

30. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

31. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

32. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

33. She is playing the guitar.

34. Hindi ako sang-ayon sa mga pangyayari sa paligid natin ngayon.

35. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

36. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

37. Higupin ng basang tuwalya ang tubig sa mesa.

38. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

39. Patunayan mo na hindi ka magiging perwisyo sa kanila.

40. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

41. Bigla niyang mininimize yung window

42. Ang mabuting kaibigan, ay higit pa sa kayamanan.

43. It was founded in 2012 by Rocket Internet.

44. Have they made a decision yet?

45. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

46. Karaniwang mainit sa Pilipinas.

47. Napangiti ang babae at umiling ito.

48. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

49. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

50. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

Recent Searches

so-calledtransparentguardacoinbasecomplicatedbowpasoktelebisyonendmillionsbreakschoolaidpossiblefiapagpapakalatremaindoktorbathalapeepbrindarnahulogbayantamisestudiomagagandaleowaringagam-agammensajesgobernadorkaawaynakabluenangyariisusuotdiindumalotagpiangtinuturosakopexigentesumasaliw3hrsvivamissionbaonicondagaleepinatidcompartensedentarybornfistsbehaviorpinagmamalakireleasedbadingnagtatrabahonatutokmayamanpaksacourtstudentskatawangdownpapagalitannagpaiyaknakakabangonpinagalitankumitakasaganaanmagkakaanaknalulungkotnakapagreklamomagtiwalanasiyahanpakikipagtagpopinapaloculturenagdiretsopaanonghumiwalayestudyantedahan-dahangirlmagbabagsikmiyerkolestumahimikmakawalashadesnakabilipaghuhugasinabutankidkiranngumiwiactualidadmakaraanuugod-ugodmagsusuotnapakahabaminerviecasesiloilona-curiousbagsakpatakbongmahahalikbalikatmakilalamatumalhawakpapuntangbotongsinehanlumusobngitiipinauutangbasketbolmarketing:masasabipaparusahannamuhaykakutishurtigerekatutubore-reviewhdtvkumirotpumuntasamakatuwidsinisihinahaplospasasalamatmanalonapadpaderoplanokastilaeksport,paliparinnaghubadniyonmasayaiwanansteamshipsinastabilugangnapadaanfionaeleksyonumanonapatingalanatuloykamingwarikonekpinilitcubapublishing,joseikinalulungkotlagunalegendsnilulonpebrerocenterindividualsmasipagsinampalhoytillhinaboljerryanaytinio10thdinanasfamenagawasawasumakitsaidtalentedboksingrosarhythmkaugnayanlossnilanghelenaelvissoreboracaypageantfullipatuloyulitspeechklimaboto