Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "films"

1. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

2. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

3. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

4. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

5. Elle adore les films d'horreur.

6. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

7. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

8. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

9. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

10. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

11. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

12. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

13. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

14. The film director produced a series of short films, experimenting with different styles and genres.

15. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

16. These films helped to introduce martial arts to a global audience and made Lee a household name

17. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

Random Sentences

1. A wife is a female partner in a marital relationship.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. The birds are chirping outside.

4. Puwede ba tayong magpa-picture na magkasama?

5. Maya-maya lang, nagreply agad siya.

6. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

7. Debemos enfrentar la realidad y no ignorarla.

8. Mathematics is an essential tool for understanding and shaping the world around us.

9. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

10. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

11. Ang sarap maligo sa dagat!

12. Bestfriend! impit na tili ni Mica habang palapit sa akin.

13. Mayroon pa ba kayong gustong sabihin?

14. Masipag manghuli ng daga ang pusa ni Mary.

15. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

16. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

17. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

18. Limitations can be a result of fear or lack of confidence.

19. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

20. The bank approved my credit application for a car loan.

21. Nasa tabi ng ilog, pinagmamasdan niya ang mga isdang naglalaro sa tubig.

22. Kailangan mong supilin ang iyong galit upang makapag-isip nang maayos.

23. Ang tubig-ulan ay maaaring magdulot ng mga sakuna tulad ng baha, landslides, at iba pa.

24. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

25. This can be a great way to leverage your skills and turn your passion into a full-time income

26. The scientist conducted a series of experiments to test her hypothesis.

27. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

28. Maganda ang kulay ng langit sa dapit-hapon.

29. A medida que la tecnología avanzó, se desarrollaron nuevos tipos de teléfonos, como los teléfonos inalámbricos, los teléfonos móviles y los teléfonos inteligentes

30. May kanya-kanyang bayani ang bawat panahon.

31. Nauntog si Jerome sa kanilang pintuan.

32. Ang saranggola ni Pedro ay mas mataas kaysa sa iba.

33. Sinabi ko nang binangga ako nang pasadya, na naramdaman ko ang kanyang kamay sa aking bulsa.

34. I don't want to cut corners on this project - let's do it right the first time.

35. Namnamin natin ang bawat sandali ng bakasyon.

36. Tengo vómitos. (I'm vomiting.)

37. Tweets are limited to 280 characters, promoting concise and direct communication.

38. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

39. Regular exercise and playtime are important for a dog's physical and mental well-being.

40. Gusto mong mapabuti ang iyong kasanayan? Kung gayon, magpraktis ka araw-araw.

41. His unique blend of musical styles

42. Si daddy ay malakas.

43. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

44. Maghanap tayo ng mga kabibi sa tabing-dagat.

45. They do not ignore their responsibilities.

46. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

47. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

48. Mabait sina Lito at kapatid niya.

49. Cancer research and innovation have led to advances in treatment and early detection.

50. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

Recent Searches

filmssusulitdisseantoniosatisfactiononeskillspierimpactnamanmerchandisebinabaratlittletindahanculturaevolvedautomaticmultoentrygraduallyjohnnakakainnagbantaynahintakutankumikiloskahariannaguguluhangpulang-pulakaloobangnakatuwaangmagta-trabahohahatolbalitakapamilyapahirapannagpabayadtinangkanilapitanstructurelumutangdispositivomagandangmagsasakabahagyasarisaringhinanakitmasasabitig-bebeintepasyaibonpootkapeadicionalesskypebasketballfithotelfathermisteryohimayintrabahowaysbeforechesstvsmajorbarriersburdenlargeexplainmakapangyarihangencompassessalonsapapwestomagbigayanyouthnananalore-reviewsisidlanmatalinofotosassociationandamingsumagotpolvosalinsingeradventdyanpagkapasokcommunicationtraininglumipaspaangpag-akyatuulaminnaglulusaknatalotumingaladisensyomusicalpalancabaryoriyanpowerpointdontmaskigraceactionwaternangyariambagilalagaynapaautomatiserebagkus,filmkalaunankinatatalungkuangkababaihanna-curioussunuginsidolupainpunocityinspirationbaronguniversitiesnohtangkagenehigh-definitionsinematabangsarasumingitpinagmariamahahanaynanlilisiknasasabihanlabing-siyampapagalitankatawangpintonakakaalamilingisuotdevelopvancontrolapuntapointcasestiniradorhinagud-hagodobservererpagsasalitanagliliyabbagyonakatirangnatawaopisinapaki-chargemahahalikbulaklaknagliwanaguugud-ugodnagtalagaclimbedsakristanmagdaraosumiyaktumikimasignaturakatutubomagsugalpagsagotmagseloshayopbinentahanpakiramdamnalugodevolucionadointerests,presentinabotpisaravaledictorianmaluwagika-50magisippadalasalaknaissellingandoymaalwang