Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "room"

1. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

2. A couple of candles lit up the room and created a cozy atmosphere.

3. A lot of laughter and joy filled the room during the family reunion.

4. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

5. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

6. Kailangan ko umakyat sa room ko.

7. Let's not ignore the elephant in the room any longer and confront the issue head-on.

8. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

9. Makikiligo siya sa shower room ng gym.

10. Pangit ang view ng hotel room namin.

11. Pupunta lang ako sa comfort room.

12. Really? What is he doing sa tapat ng room natin?

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

15. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

16. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

17. The hotel room had an absolutely stunning view of the city skyline.

18. There were a lot of toys scattered around the room.

19. Tinulungan ko siyang dalhin yung mga plato sa dining room.

20. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

21. We have been painting the room for hours.

22. We need to address the elephant in the room and discuss the budget issues.

23. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

Random Sentences

1. Maraming mga mahuhusay na maghahabi ang tumaggap sa hamon ng batang si Amba.

2. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

3. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

4. Inaamin ko na ang pagkakamali ko.

5. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

6. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

7. Naaksidente ang aming plano sa bakasyon dahil sa pagbaha sa lugar na aming pupuntahan.

8. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

9. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

10. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

11. Maraming taon na ang nakaraan, may isang munting baranggay sa paanan ng isang bundok.

12. Matagal akong nag stay sa library.

13. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

14. The company’s momentum slowed down due to a decrease in sales.

15. Walang sinuman ang nangahas na kontrahin ang plano ng kanilang lider.

16. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

17. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

18. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

19. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

20. Dumating siya mula sa Bikol kahapon ng umaga.

21. Anong karangalan ang ibinigay sa kanya?

22. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

23. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

24. Memberikan dan melakukan tindakan baik kepada orang lain dapat meningkatkan kebahagiaan kita.

25. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

26. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

27. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

28. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

29. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

30. Though I know not what you are

31. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

32. Ang kalawakan ay punung-puno ng mga bituin.

33. Crush kita alam mo ba?

34. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

35. Limitations can be a result of societal or systemic inequalities and discrimination.

36. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

37. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

38. Eh? Considered bang action figure si spongebob?

39. The feeling of baby fever can be both exciting and frustrating, as individuals may face challenges in fulfilling their desire for a child, such as infertility or other life circumstances.

40. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

41. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

42. Sa sobrang pagpapatubo sa perang ipinauutang, galit na galit ang mga mangingisdang hindi makapalag sa kaswapangan ng kanilang kababayan.

43. She has won a prestigious award.

44. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

45. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

46. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

47. Ang mabuting anak, nagpapakilala sa magulang.

48. Alors que certaines personnes peuvent gagner de l'argent en jouant, c'est un investissement risqué et ne peut pas être considéré comme une source de revenu fiable.

49. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

50. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

Similar Words

classroom

Recent Searches

iguhitroombukodipinadalasuccessfulmorenahiningimahahabatransmitsgoodeveningbentangmaingatbirthdaycuentanexampinalutokaringmulighedipagamotloricigarettescompostelasamfundbalingtapossystematiskbownerissadulabathalaipapahingaestablisheddidingdoonpinalakingviewsintroducecomplicatedvisualtipwhilerequiregeneratedbitbitreturnededit:largeableinvolveallowspersistent,lapatetoasalpatientstartipagtanggolhappenedbilibtatlumpungmurang-muranakabluemangyaritagpiangrecordedumiinommahuhusaycubiclemisyunerongwaringatentoipapautangumanomalamangmabaitexpertisedancerenatoipapaputolsomehalipultimatelytinapaydulotsuccessbroadcastssaringbaulapollohaftremotebinilingrepresentativeresearchryanaidkumbinsihingasmenmadaliprosesoupuandasalkahaponpuwedetaga-hiroshimadaladalaisasamaparkipaliwanagbairdmalaboorugapalagimustupotikethousepalapitsoccercomunicanwaitcantotatawagansinasadyapagtataaspagtangismagkapatidnanlakikagandahanlabing-siyamnakadapanaguguluhangnagpuyosnakaupohubad-baropagkuwakalayaanpagsasalitapunong-kahoynapakagandangkondisyoninterests,tumatakbobowllalabhanumagawsinaliksikpumayagkayabangannaiilangpamumunoilalagaykinasisindakanbulaklakgumagamitlumakasmahiyanapagtantonasiyahanbabasahinnagbantaypumitaspakakatandaantuwingunandepartmentginawanginhalesarisaringnapawiumikotpantalonmusictinungomakaiponmaghaponsiyamkaparehaanilamarilouforskelmaghintayhuertobutisementoninyongboyfriendkassingulangunconstitutionaleksport,klasengtsssknightsagapofrecentibigsumisilipcolorkendigrowth