Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "room"

1. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

2. A couple of candles lit up the room and created a cozy atmosphere.

3. A lot of laughter and joy filled the room during the family reunion.

4. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

5. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

6. Kailangan ko umakyat sa room ko.

7. Let's not ignore the elephant in the room any longer and confront the issue head-on.

8. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

9. Makikiligo siya sa shower room ng gym.

10. Pangit ang view ng hotel room namin.

11. Pupunta lang ako sa comfort room.

12. Really? What is he doing sa tapat ng room natin?

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

15. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

16. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

17. The hotel room had an absolutely stunning view of the city skyline.

18. There were a lot of toys scattered around the room.

19. Tinulungan ko siyang dalhin yung mga plato sa dining room.

20. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

21. We have been painting the room for hours.

22. We need to address the elephant in the room and discuss the budget issues.

23. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

Random Sentences

1. Mahal ang mga bilihin sa Japan.

2. Walang anuman saad ng mayor.

3. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

4. There are so many coffee shops in this city, they're a dime a dozen.

5. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

6. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

7. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

8. Bumibili si Erlinda ng palda.

9. Sa kasal, karaniwang nagmula ang mga panalangin upang hilingin ang magandang buhay para sa mag-asawa.

10. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

11. Ang daming pulubi sa maynila.

12. El nacimiento de un bebé es motivo de alegría y celebración.

13. Knowledge is power.

14. Hindi dapat magbase ng pagpili ng mga kaibigan sa kanilang kababawan, kundi sa kanilang pagkatao.

15. Basketball is a team sport that originated in the United States in the late 1800s.

16. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

17. Ano ang gustong sukatin ni Elena?

18. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

19. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

20. Napakatagal sa kanya ang pagkapuno ng mga balde ni ogor.

21. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

22. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

23. Sa paglipat niya sa ibang bansa, kinailangan niyang mag-iwan ng mga kaibigan at pamilya.

24. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

25. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

26. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

27. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

28. Ang droga ay isang mapanganib na sangkap na maaaring magdulot ng malubhang mga epekto sa kalusugan ng isang tao.

29. I am exercising at the gym.

30. Einstein was a pacifist and advocated for world peace, speaking out against nuclear weapons and war.

31. The judicial branch, represented by the US

32. Kailan ba ang flight mo?

33. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

34. Umulan man o umaraw, darating ako.

35. A father's love and affection can have a significant impact on a child's emotional development and well-being.

36. Sino ang kasama niya sa trabaho?

37. The conference brings together a variety of professionals from different industries.

38. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

39. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

40. El cultivo de hortalizas es fundamental para una alimentación saludable.

41. Hindi pa rin siya umaalis sa kinauupuang balde.

42. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

43. The concept of money has been around for thousands of years and has evolved over time.

44. Nice meeting you po. nag smile sila tapos nag bow.

45. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

46. Ang daming tao sa divisoria!

47. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

48. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

49. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

50. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

Similar Words

classroom

Recent Searches

roomagadeliteiatfskypechangedtradebayabaskaninamobilechecksjoyferrertsaaencounterpalayankutissubjectpinagpalaluancontinuerequireipinalitmultocancerumuwingsumasayawpangkatbakapaghahabipinagsasasabitinderasincenagibangexplainpangangailanganbathalabagamananghuhuliarghnangagsibilikadalascompostmulaquarantinedilagumibigibabawngusopogimalayongsomethingmurang-muragobernadornapakamisteryosokawili-wiliespecializadaskaloobangpresidentialkinamumuhiannaninirahanbuung-buohospitalmakahiramtiniradorkinauupuangmensajesnasasabihankonsultasyonpagtatanongmaglalarouugud-ugodpagkalitonakikianagliwanagkasyaninanaiskumakaininaaminyakapinkakaininnagagalitkapitbahaymag-anaklalabaspabulongasignaturanaiisippagsagotmisyunerongmakakamaya-mayamaynilaginawarannangingilidutilizanunangnahantadnagpasyarecibirexcitedresearch,mauliniganebidensyasarongpalayotinitindamakinangaddictionrestawrancalidadtodaskaysaayokotrenmarmainginakyatmatabangcnicofeltbalingnaghinala1876bingibranchaddingtabayeahallowsissueskinuhanakatulogavailabledyanoutlinesdagaseektalenteddadroqueharinuclearpreskomagkipagtagisanparicountriesnamumuonatinnananalodarkpoolre-reviewmasasabinawalangsignnakararaanbayangnaghandangbaguiomanakboassociationsayomarasigancultivatataypagtangisnagmistulangnakapagusapkagayahitikkinakailanganbulaklolaaroundmulighedermagalangentrancefranyanghudyatnilolokoedukasyonabigaeldakilangnangyarirosariomaskinerahaseksenapumuntadaminakakakuhakamikahaponawardmagbabagsikpinahalatakarwahengrenombremarketplacesmakuhang