Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "room"

1. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

2. A couple of candles lit up the room and created a cozy atmosphere.

3. A lot of laughter and joy filled the room during the family reunion.

4. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

5. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

6. Kailangan ko umakyat sa room ko.

7. Let's not ignore the elephant in the room any longer and confront the issue head-on.

8. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

9. Makikiligo siya sa shower room ng gym.

10. Pangit ang view ng hotel room namin.

11. Pupunta lang ako sa comfort room.

12. Really? What is he doing sa tapat ng room natin?

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

15. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

16. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

17. The hotel room had an absolutely stunning view of the city skyline.

18. There were a lot of toys scattered around the room.

19. Tinulungan ko siyang dalhin yung mga plato sa dining room.

20. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

21. We have been painting the room for hours.

22. We need to address the elephant in the room and discuss the budget issues.

23. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

Random Sentences

1. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

2. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

3. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

4. The store offers a variety of products to suit different needs and preferences.

5. The officer issued a traffic ticket for speeding.

6. Iinumin ko na sana ng biglang may umagaw.

7. Después de hacer la compra en el supermercado, fui a casa.

8. La paciencia nos enseña a esperar el momento adecuado.

9. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

10. Pinahiram ko ang aking golf club sa aking kaopisina para sa kanilang tournament.

11. Ngumiti muna siya sa akin saka sumagot.

12. Matapos ang kanyang tagumpay, si Hidilyn Diaz ay tumanggap ng maraming parangal mula sa gobyerno at pribadong sektor.

13. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

14. She admires the beauty of nature and spends time exploring the outdoors.

15. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

16. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

17. Omelettes are a popular choice for those following a low-carb or high-protein diet.

18. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

19. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

20. Saan mo dinala ang dinukot mo sa aling ito?

21. Ow, sorry nagising ata kita. aniya.

22. Magsi-skiing ako sa buwan ng Enero.

23. La historia del arte abarca miles de años y se extiende por todo el mundo.

24.

25. Mahilig siyang mag-ehersisyo at kumain ng masustansya, samakatuwid, malakas ang kanyang pangangatawan.

26. Nakarating ako ng 4th floor at ako pa rin ang pinag uusapan.

27. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

28. Ang kulay ng langit sa takipsilim ay parang obra maestra.

29. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

30. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

31. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

32. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

33. Tengo muchos amigos en mi clase de español.

34. Anong nginingisi ngisi mo dyan! May balak ka eh! Ano yun?!

35. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

36. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

37. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

38. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

39. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

40. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

41. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

42. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

43. Hindi dapat sumuko agad kapag mailap ang posibilidad ng tagumpay.

44. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

45. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

46. I've got a big presentation at work today - I hope I don't break a leg!

47. I am enjoying the beautiful weather.

48. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

49. Nasisilaw siya sa araw.

50. Ayaw ng kaibigan ko ang mainit na panahon.

Similar Words

classroom

Recent Searches

roommagbibiladmagkaibigannakabaontaksinagtitiislordspecialmatangpeso1940matangumpayfatpagonghonestomismobossbabasahinsayanaiinitanmagagawatinungoplanning,madamidakilang18thestasyonnagpapaniwalakaybilisyakapinpaglingonsikatpalantandaanbinatangmawawalafigureshowsnaninirahan1920smerrylamangtinutoppaidmodernemahiwagangnakakapagpatibayhydeliintayinmurangpag-aapuhapunconstitutionalinihandasakay4thngisimatumalvidtstraktnakausling1787sinumangnahihilolalongipinikitbatokkassingulangpambahaynagmakaawamagbalikkolehiyotibokcoachingsurveyspeepfamenabigaykasaysayankusinarequiremininimizesulinganpocasofaitinaligjortumikotviewrebounddisappointburdenpaskoinalispagkakamalistylesnanghahapdidaladalanothingkuboutilizajosieinumintawanancompanieskuyasumakaykikitanag-alalanginingisisingaporenasabingfrescojobstsongpakukuluanpuntahanrelievedabundantepinagawakataganggoodeveningintroduceugatlayassakimhinilamagawapinakamahabalilimbiyernesbisitakinapanayamhayaantravelerhousebusyangpinasalamatankusineropinigilantinawagnaapektuhanentrancekaraniwangculturasbutikonsultasyonpinabayaanmangyaripinagtagpopartspoliticalricasponsorships,velstandlaylaykumitanagtinginanmatikmansiyanaguguluhangwikadipangmaminahigitanrockwidelyalanganmagpakaramimagbibigaydisenyongnanigaskabiyakrelolondonpakibigayokaysakenkasalukuyanpetsanginfusionesunahinmasaholtawaplanmapapawaysbowbillhinipan-hipannaglipanangnagtatrabahosenatebellkabosesinilalabaskaniyakasoynatatanawnakakunot-noonggumalakondisyonnasisiyahan