Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "help"

1. A balanced and healthy diet can help prevent chronic diseases.

2. A couple of cups of coffee in the morning help me start my day.

3. A lot of people volunteer their time and resources to help those in need.

4. A wedding planner can help the couple plan and organize their wedding.

5. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

6. Adequate fiber intake can help regulate the digestive system and maintain gut health.

7. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

8. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

9. Apa yang bisa saya bantu? - How can I help you?

10. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

11. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

12. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

13. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

14. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

15. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

16. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

17. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

18. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

19. Electric cars can help reduce dependence on foreign oil and promote energy independence.

20. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

21. Emphasis can help clarify and reinforce the meaning of a message.

22. Emphasis can help to ensure that a message is received and understood by the intended audience.

23. Football coaches develop game plans and strategies to help their team succeed.

24. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

25. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

26. Hockey coaches develop game plans and strategies to help their team succeed.

27. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

28. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

29. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

30. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

31. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

32. Many people start their day with a cup of coffee to help them wake up and feel more alert.

33. Meal planning and preparation in advance can help maintain a healthy diet.

34. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

35. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

36. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

37. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

38. Pets, including dogs, can help children develop empathy and responsibility.

39. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

40. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

41. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

42. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

43. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

44. Seek feedback, it will help you to improve your manuscript

45. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

46. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

47. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

48. Supporting policies that promote environmental protection can help create a more sustainable future.

49. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

50. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

51. The acquired assets will help us expand our market share.

52. The company's acquisition of new assets will help it expand its global presence.

53. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

54. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

Random Sentences

1. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

2. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

3. Laking gulat niya nang mawala ang batang umiiyak.

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. Sa pagtitipon ng mga lider ng relihiyon, ibinahagi nila ang kanilang mga mungkahi upang mapalakas ang pananampalataya ng mga miyembro.

6. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

7. Good things come to those who wait

8. Sorry hindi kita nasundo. apologetic na sabi si Maico.

9. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

10. Noong una ho akong magbakasyon dito.

11. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

12. Sa kanyang lumang bahay, makikita mo ang kanyang koleksyon ng mga antique na kagamitan na hitik sa kasaysayan.

13. After months of hard work, getting a promotion left me feeling euphoric.

14. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

15. Siya ho at wala nang iba.

16. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

17. The dancers are not rehearsing for their performance tonight.

18. The culprit behind the data breach was able to exploit a weakness in the company's security.

19. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

20. Bakit ba? Hinde ba ko pwedeng magsungit?

21. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

22. Kung minsan, akala ng mga tao, masungit siya.

23. Gracias por entenderme incluso cuando no puedo explicarlo.

24. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

25. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

26. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

27. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

28. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

29. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

30. Ang mobile legends ay sikat na sikat sa mga pinoy.

31. Lumiit ito at nagkaroon ng mga mahahabang paa.

32. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

33. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

34. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

35. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

36. Papunta na ako dyan.

37. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

38. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

39. Durante las vacaciones, a menudo visitamos a parientes que viven lejos.

40. Malaya na ang ibon sa hawla.

41. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

42. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

43. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

44. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

45. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

46. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

47. Ano ang suot ng mga estudyante?

48. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

49. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

50. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

Similar Words

helpedhelpful

Recent Searches

helpyoukatapatitinagowaymaputinag-ugatt-ibangnalugisittingpapasamasusunodmanghikayatpagkahapolookedmataraypublished,magbakasyonpedekahusayanespecializadasebidensyaninumannag-oorasyonipantalopsistemascertaingamotmartialtherapynilalangbihiraikinuwentoimpactnalugmokwhetherwalangnanlilisikrenacentistapagkaangatgutomlilimnapakahabanyankapatawaranmakikitabintanaprovehawaiimatandang-matandabipolarkundiutilizaestilostinikltoikawmankumaripasnakatitigdevelopmenthoyhomesnatigilandilajustinnaabutanprobablementenapadpadpaladkumukuhaenhedernaistaga-suportabilihintongpundidowaitheartbreaknyaMangangalakalconvertingmahirappakpaknaghandangtulisaniphonekapangyarihangduraspinagkakaguluhanmangingisdangiyongmind:ganyanklasepinoykaklaseitinindighigupinpilingtalinoipakitadahonaninagc-cravenatinkissalintuntuninmasipagexpeditednakakasonidoipinanganaktemperaturanag-aasikasolumungkotwonderspagsalakaydapatsignificantnag-aalalangkampanainatakemarahasprinsipecomfortbinigyangmapayapanakatulogpinakamahalagangdurikangitaniintayinplatonagliliyabkatawanstrategiesproporcionarhumaliklamesadaan11pmbillmissimprovetaingaipagmalaakibirthdayipinatawagmaghahandapagkainiskurakotcontrolledrestaurantmahiwagangngunitsupilindalawampumagalangbrasopagkaraanbookoftenvasquesipinakitariskmasayanggradbungadnapakabiliseachperokuwadernonagtatampobevarebeginningstheirbernardomamimilimaghaponpang-araw-arawressourcernemanycelularesiyandenhimutoktaglagaskagandahantipnahulipagkapasokpinaliguannamangtumalonfollowing,unopagtangoawitinkasoy