Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

54 sentences found for "help"

1. A balanced and healthy diet can help prevent chronic diseases.

2. A couple of cups of coffee in the morning help me start my day.

3. A lot of people volunteer their time and resources to help those in need.

4. A wedding planner can help the couple plan and organize their wedding.

5. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

6. Adequate fiber intake can help regulate the digestive system and maintain gut health.

7. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

8. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

9. Apa yang bisa saya bantu? - How can I help you?

10. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

11. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

12. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

13. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

14. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

15. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

16. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

17. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

18. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

19. Electric cars can help reduce dependence on foreign oil and promote energy independence.

20. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

21. Emphasis can help clarify and reinforce the meaning of a message.

22. Emphasis can help to ensure that a message is received and understood by the intended audience.

23. Football coaches develop game plans and strategies to help their team succeed.

24. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

25. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

26. Hockey coaches develop game plans and strategies to help their team succeed.

27. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

28. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

29. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

30. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

31. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

32. Many people start their day with a cup of coffee to help them wake up and feel more alert.

33. Meal planning and preparation in advance can help maintain a healthy diet.

34. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

35. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

36. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

37. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

38. Pets, including dogs, can help children develop empathy and responsibility.

39. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

40. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

41. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

42. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

43. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

44. Seek feedback, it will help you to improve your manuscript

45. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

46. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

47. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

48. Supporting policies that promote environmental protection can help create a more sustainable future.

49. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

50. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

51. The acquired assets will help us expand our market share.

52. The company's acquisition of new assets will help it expand its global presence.

53. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

54. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

Random Sentences

1. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

2. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

3. Hinde no. Baka kasi pag tumaba ako ipagpalit mo ko bigla eh!

4. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

5. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

6. All these years, I have been blessed with the love and support of my family and friends.

7. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

8. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

9. Pero sa isang kondisyon, kailangang bayaran mo.

10. Walang sinasabi ang mga ito, ngunit sa mga mata, sa galaw ng mga labi nababasa nya ang isinisigaw ng mga paslit.

11. Sa isang pagamutan ng pambansang bilangguan sa Muntinlupa ay makikita ang apat na lalaking may kanya-kanyang karamdaman

12. Luluwas ako sa Maynila sa Biyernes.

13. Sa Manila Hotel ka titigil, hindi ba?

14. Ang buhay ay isang mumunting paraiso lamang.

15. Magpupunta kami ng hospital mamaya upang magpa-checkup.

16. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

17. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

18. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

19. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

20. Ayaw ng nanay kong magtrabaho sa Linggo.

21. Software er også en vigtig del af teknologi

22. I have never been to Asia.

23. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

24. She missed several days of work due to pneumonia and needed to rest at home.

25. May email address ka ba?

26. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

27. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

28. Narinig kong sinabi nung dad niya.

29. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

30. The construction of the building required a hefty investment, but it was worth it in the end.

31. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

32. He forgot his wallet at home and therefore couldn't buy lunch.

33. He has been hiking in the mountains for two days.

34. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

35. Ano ang nasa ilalim ng baul?

36. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

37. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

38. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

39. Le tabagisme est un facteur de risque majeur pour de nombreuses maladies, notamment les maladies cardiaques et le cancer.

40. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

41. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

42. Walang mahalaga kundi ang pamilya.

43. Hindi umimik si Lory sa mga tanong ni Chad.

44. Tak ada rotan, akar pun jadi.

45. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

46. Nagkatinginan ang mag-ama.

47. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

48. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. Te agradezco por estar siempre ahí para mí.

Similar Words

helpedhelpful

Recent Searches

helpsectionstenidonagtaastinitindainihandailalagaysetsalltsssespadabandangnaglabakamotemaghahabiresearch,saan-saanteachconinanagkakasayahandulagumandanag-aagawannuclearblusarooncrametradisyonbuhawimatalinomalalimisasagotinilalabasiniisipkubyertosdayslasingeronag-aabanggusting-gustomagagandanggirlcharitablenakapasokaktibistamawalasaturdayagagelaiharimag-ibagymlamanumokayaga-agasoremagbagong-anyoeksperimenteringafterbanlagpaatingingprinsesanasisilawdriverlarotanimnagsisilbiinterpretingvigtigalas-dosesakitpagpanawnapadpadhalu-halopagkakakawitperpektokundipakpakkinikilalangnaismagkababataumaasalamesaskillpyschemarasigansupilinkagandahantransityariagepag-isipanapelyidotanganparaisomasoktreatsmagkakaanakmanyagadrevisegumawaimpactshinanakitsilangsilyatulongwalangnagwo-workbinatangwhylalamunanpagtataposbangkangpaidadakulay-lumotnasilawsisipainremotehiramlastaga-ochandopwedeendbarung-barongkantapakilagaybigonggustongnagpakunotnakuhaditonilakalabawdreamsnakakatulongcedulakaninaipinansasahogfascinatingpanalanginnakayukobabalikknowmamimilicigarettebokasahanbateryahaftnaroonmediaexamplebarongkamabinabalikreaksiyontilithingconnectdisyembregetnangahaslearningyearkamalayankababayanflamencotengadistancialobbybatotabihandaangmagkanomagnanakawbiyasmangingisdangitemspapayagika-12maramottabianiquelimosdalifundrisegagandalimitbalatdiretsosasamamaligayacasatanggalinkaniyaamerican