Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "variedad"

1. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

2. Hay miles de especies de serpientes en todo el mundo, con una amplia variedad de tamaños, colores y hábitats.

3. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

4. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

5. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

6. La música española es rica en historia y diversidad, con una variedad de géneros y estilos

7. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

8. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

9. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

10. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

11. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

Random Sentences

1. The king's family and heirs are often closely watched by the public and the media.

2. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

3. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

4. Nationalism has been used to justify imperialism and expansionism.

5. Oh di nga? Nasaang ospital daw?

6. Work can also have a social aspect, providing opportunities to meet new people and make connections.

7. He has visited his grandparents twice this year.

8. Ang pagkakaroon ng disiplina sa sarili ay mahalaga upang magkaroon ng maayos na pamumuhay, samakatuwid.

9. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

10. "Manalig ka sa Diyos at hindi ka mapapahamak," ani ng pari sa kanyang sermon.

11. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

12. Let's just hope na magwork out itong idea ni Memo.

13. I admire my mother for her selflessness and dedication to our family.

14. A balanced and healthy diet can help prevent chronic diseases.

15. I know I should have gone to the dentist sooner, but better late than never.

16. A caballo regalado no se le mira el dentado.

17. Los blogs y los vlogs son una forma popular de compartir información en línea.

18. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

19. La persona ebria en la calle está llamando la atención de los transeúntes.

20. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

21. Nagbabaga ang hangarin ng mga kabataan na magtagumpay sa kabila ng mga hamon.

22. Ang kalayaan ay hindi dapat nakasira sa kapakanan ng ibang tao.

23. Many charitable institutions rely on volunteers to sustain their programs.

24. Me gusta preparar infusiones de hierbas para relajarme.

25. Limitations can be overcome through perseverance, determination, and resourcefulness.

26. Happy birthday sa iyo!

27. Børn bør have adgang til sunde og næringsrige fødevarer for at sikre deres sundhed.

28. Hindi umimik si Aling Marta habang minamasdan ang bata.

29. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

30. If you did not twinkle so.

31. Ako na ang bahala dito. aniya at akmang tatayo na.

32. Gusto kong maging maligaya ka.

33. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

34. Many people work to earn money to support themselves and their families.

35. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

36. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

37. Oo nga babes, kami na lang bahala..

38. Nagkaroon sila ng maraming anak.

39. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

40. Ano ang isinulat ninyo sa card?

41. Lagi na lamang itong nag fe-facebook.

42. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

43. Ilang tao ang nahulugan ng bato?

44. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

45. Sa harap ng outpost ay huminto ang pulis.

46. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

47. You got it all You got it all You got it all

48. Adequate fiber intake can help regulate the digestive system and maintain gut health.

49. Practice makes perfect.

50. Sana ay masilip.

Recent Searches

variedadsinaliksikdahancertaininteligentessupportdahan-dahanganangexpertisepaksayeysagingprofessionalnagdaramdamcombinedpagtawalibertykinakainmalimitelectedwithoutbinatovirksomhedertumagalmorningpambahaykatutuboeksamtinayartistsagapkongresotodaymagtagohaponeconomicescuelasmasukolquarantinekontinentengnakakapuntadakilangpakikipagbabagumalissapagkatcloselupalopbesescharismaticpeepmodernenag-replyhitiklilimtabing-dagatdiyanmalusogsparkhamakbatonaglalatangnagliliyabkalalakihannagsinepinalalayasnakabibingingtemperaturalondonvideosnakataasnagagamitpagtangisnanlakimakidalokarwahengkalabawtatawaganpagkakalutonagsisigawnagmamaktolmabangomakapangyarihanghascafeteriapodcasts,sagasaanmagpapabunotremainpinangyarihanjoshcommercialeksportentelephoneforskelanumangsusunodwagsocialepatongnetflixultimatelyumutangmabaitpaskongtinitirhandulotjacewestarghotrasdaigdigmaranasanpag-iinatmuchbinilingbilerwaterdaanstoredescargargownlegendsginagawacablesasakyandoonrecentlychangednakatinginmatikmansumisilipkainisgurokinagigiliwangngisirestaurantikinakagalitnagkapilatmahawaanyumabongnahigitannakahainedukasyonpagdiriwangnakapagproposenaiilangataquesanilapatakbongpostcardkamatislubosnuncelularespakaintwinkletenbackhittoyeachbookbabareadbobotonakabuklatduranteheibellpagdudugotilapookwesleyaksidentesettingnagmasid-masidtinitindapinaulanankesobuung-buobinatakliligawankare-kareexigentetiktok,makapagmanehosenadorhehepanamakaninacondofacebookkirbyresearchipinaalamsanglangkaynamingmagselosopo