Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ydelser"

1. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

Random Sentences

1. Sí, claro, puedo prestarte algo de dinero si lo necesitas.

2. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

3. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

4. Anong ginagawa mo?! mataray pang sabi nito.

5. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

6. TikTok has become a cultural phenomenon, with its own language and trends that have spilled over into mainstream culture.

7. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

8. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

9. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

10. Paborito ko kasi ang mga iyon.

11. The judicial branch, represented by the US

12. Comer regularmente comidas pequeñas y saludables durante todo el día puede ayudar a mantener niveles de energía estables.

13. I woke up to a text message with birthday wishes from my best friend.

14. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

15. If you think I'm the one who broke the vase, you're barking up the wrong tree.

16. For eksempel kan vi nu tale med vores enheder og få dem til at udføre opgaver for os

17. Repeated frustration can lead to feelings of hopelessness or helplessness.

18. Ang palay ay hindi bumubukadkad kung walang alon.

19. Vielen Dank! - Thank you very much!

20. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

21. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

22. Ang guro ko sa Panitikan ay nagturo sa amin ng mga panitikan mula sa iba't ibang panahon.

23. Ang kamatis ay mayaman din sa vitamin C.

24. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

25. Uncertainty is a common experience in times of change and transition.

26. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

27. Anong hindi? Eh pulang-pula ka na oh!

28. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

29. Paliparin ang kamalayan.

30. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

31. Paano mo pinaghandaan ang eksamen mo?

32. Las hojas de mi planta de menta huelen muy bien.

33. Las vendas estériles se utilizan para cubrir y proteger las heridas.

34. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

35. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

36. They have won the championship three times.

37. Athena. nagulat siya at bigla niyang pinatay yung monitor.

38. Mi amigo me prestó dinero cuando lo necesitaba y siempre le estaré agradecido.

39. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

40. Kung walang tiyaga, walang nilaga.

41. Aku rindu padamu. - I miss you.

42. He's always the first one in the office because he believes in the early bird gets the worm.

43. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

44. Paano ho ako pupunta sa Palma Hall?

45. Nasa harap ng pinto ang dalawang aso.

46. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

47. Wala akong maisip, ikaw na magisip ng topic!

48. Las compras en línea son una forma popular de adquirir bienes y servicios.

49. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

50. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

Recent Searches

nababalotydelserbayaningmassachusettslumbaymaranasanlakadsampungunangjosefacombinedgoalbansangilawnagpuntacoalmarmaingdailymaidaffiliatenatulogtelefonimagesfriendtugonbagkusmaistorbodaladalagamitinpalapitipantaloppresyomarvinsentencesumagotleadingmadamotpasensyaskyldesumangatbesidespakelampootcryptocurrency:contestdoktoreventsshowsnagdaramdamlawswordheylulusogamongjerrymisusedconectadostingredesmayoipasokbornpalayanfinisheddragonspalacksatisfactionsteveherevaledictorianpaanongalituntuninhimigneedlessideadulastylesdositlogbabeaddpersonsquicklyexplainlutuinbinilingwriteyeahbehaviorsolidifyonlypackagingculturetamadpumupuntainteligentessagingsaranggolacelularestubigginhawanunghomenalalaglaglamangkinapanayamkulisapnaglipanangpagitansapatosmatatandapinapasayapaglayaswidepaggawakasobulongbyetreshinagpisdayspedekisapmatakalakiyanpaghunishiftniyankasaysayanlimospaki-translatestrategiesbangkomaintindihansugatangsarilingpag-aagwadoraga-agajudicialpwedelahatfreehusosalarinorderintoreteasohiningiklasrumbusogeducativasparangoperahannagdarasaldiscoveredhdtvlaki-lakieskwelahanmakakatakaskinauupuangmakitanagtuturonagtutulunganikinalulungkotfilmmadilimnaibibigayselebrasyonpaumanhinkare-karemanghikayatnakasimangotnaiyaknapaiyakmagpagalingmakatarungangliv,paghihingaloinasikasoinferiorespanghihiyangtumatakbopersonaspalamutinagsinemiyerkulesmauupopaparusahanfysik,pumilitungkodmanirahanisinuotgiyeraprodujotahananlangkaynakapaligidunti-unti