Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "pace"

1. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

Random Sentences

1. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

2. Napagkasunduan ng grupo na i-expel ang miyembro na na-suway sa kanilang code of conduct.

3. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

4. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

5. Nakabili na sila ng bagong bahay.

6. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

7. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

8. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

9. Las drogas pueden tener efectos devastadores en la vida de las personas.

10. Ang mga bata ay lumabas ng paaralan nang limahan.

11. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

12. The king's role is often ceremonial, but he may also have significant political power in some countries.

13. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

14. Mahirap hanapin ang kasagutan sa kaibuturan ng suliranin.

15. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

16. Guten Abend! - Good evening!

17. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

18. Investors can purchase shares of stocks through a broker or online trading platform.

19. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

20. The car broke down, and therefore we had to call for roadside assistance.

21. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

22. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

23. Sino ang maghahatid sa akin sa pier?

24. Sa pakikipag-ugnayan sa ibang tao, huwag magpabaya sa pakikinig at pang-unawa sa kanilang mga saloobin.

25. A palabras necias, oídos sordos. - Don't listen to foolish words.

26. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

27. They have been playing tennis since morning.

28. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

29. Payapang magpapaikot at iikot.

30. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

31. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

32. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

33. Ipinagbibili ko na ang aking kotse.

34.

35. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

36. Nabagalan ako sa simula ng pelikula.

37. Bakit sila nandito tanong ko sa sarili ko.

38. At ang hawak nitong bangos na tig-bebeinte.

39. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

40. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

41. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

42. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

43. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

44. Omelettes are a popular choice for those following a low-carb or high-protein diet.

45. He was known for his active and controversial presence on social media, particularly Twitter.

46.

47. Hinawakan ko yung tiyan ko, Konting tiis na lang..

48. My grandma called me to wish me a happy birthday.

49. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

50. Siya ho at wala nang iba.

Recent Searches

whynagsuotmagdaanpacenakasakitmalampasanmanlalakbaymangyarilaroayudaandroidsupportnagcurvemakikitulogmananakawtutusinaaisshautomaticeasiernakaliliyongandrewkilalakinakitaankaninokahaponduonkamakailantumigilcoinbasefacebookbagamatsquatternaawatiyakorderinamuyinasimfluiditymagkasintahansharmainevedvarendefurytanghalinagwelgadilimginanghagdanernanpaldapondoproducirdisappointnanonoodmachinespangalanannakinigauthorpdaregularmentesiopaosiniganglagaslasnagpaalampagkagusto1973leadinghulihanbilinpaticompanyrisenapuyatkabighawalngmagbagong-anyonaglahowashingtonmagsalitainangtransparentellabook,greaterhandaansuccessyouthtransportnagsagawaganidganitoriyanpersonalpangingimibairdagoskatuwaanpangakoingatanpriestwordsumiiyakmakapaibabawuniversityginisingisuboaktibistaexistrobotickungpangkatmatakotnagbabasasikre,cultivonakakitanapaplastikandiyoschildrenhitaflyvemaskinerpigilansementojejubitbitnatuloypundidobumalikgreatnanlalamigmukaengkantadangspeedpadabogsumisilipnatitiyakfreepasensyamalumbaybehindmakikiligoadicionalesschoolstime,kulotcolorumiinitsarasagingnenareguleringtshirtdigitaltumamisumokaynagulatmatarayspamagbigayantransmitsmangingisdamagsisimulatatayopumikitdoneexpectationsilankababayangillegalformsgeneratedtextooutlinepinalutowindowstrategiesnapapatungomagnakawevolucionadonagbabagaangelagobernadorsisikatdiliginnaghubad4thdagadisensyotapehigithomesandalipagtangisfertilizerunconstitutionalmanuelalagainalagaannasaang1000sapilitang