Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "nangangahoy"

1. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

2. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

Random Sentences

1. Gusto ko sanang ligawan si Clara.

2. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

3. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

4. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

5. Les crises financières peuvent avoir des répercussions importantes sur l'économie mondiale.

6. The meeting was cancelled, and therefore he had the afternoon off.

7. We have seen the Grand Canyon.

8. Instagram has become a platform for influencers and content creators to share their work and build a following.

9. Hiram na kasuotan ang ginamit niya para sa theme party.

10. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

11. Ang Mabini Bridge ay isang makasaysayang tulay sa Lipa City, Batangas.

12. Nakita ko namang natawa yung tindera.

13. Alam mo naman na mabait si Athena, di ba?

14. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

15.

16. Mabait ang nanay ni Julius.

17. Ang tanda niyang laman ng kanyang kalupi ay pitumpong piso na siyang bigay na sahod ng kanyang asawa nang sinundang gabi.

18. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

19. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

20. Malamang na tamaan ka pa ng kidlat.

21. Nagkwento ang lolo tungkol sa multo.

22. Hindi naman sa ganun. Kaya lang kasi...

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. The reviews aren't always reliable, so take them with a grain of salt.

25. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

26. Gusto ko hong gumawa ng reserbasyon.

27. Kumusta ho ang pangangatawan niya?

28. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

29. Has he learned how to play the guitar?

30. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

31. Emphasis can help clarify and reinforce the meaning of a message.

32. She opted for a lightweight jacket to wear during her morning run.

33. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

34. Nasa loob ng bag ang susi ko.

35. Software er også en vigtig del af teknologi

36. Ang magnanakaw ay napag-alamang anak ng isang kilalang kriminal sa lugar.

37. Ang edukasyon lamang ang maipapamana ko sayo.

38. Ang salitang "laganap" ay nangangahulugang malawakang kumakalat, umiiral nang malawakan

39. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

40. A couple of actors were nominated for the best performance award.

41. Give someone the benefit of the doubt

42. Eh ayoko nga eh, sundae lang talaga gusto ko.

43. The United States is a federal republic, meaning that power is divided between the national government and the individual states

44. Eh ano ba talaga problema sa bagong maid mo?

45. The stock market can be influenced by global events and news that impact multiple sectors and industries.

46. Miss, nakalabas na ba yung pasiyente dito?

47. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

48. Pagkatapos nila mag-usap at pagkapasok ni Helena sa kanyang kwarto ay nilapitan ni Haring Bernardo ang binata at kinausap ito

49. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

50. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

Recent Searches

nangangahoypagtinginbalitanabighanikongresotindanailigtasmagandangdepartmentcosechar,nakahainlansangandifferentpilitdinalawtenidoutilizannatakotgermanykalabaniigibgurogloriamaatimsusulitsoundcarbonpangilinantokwalngadicionalespangingimibilintelangsweetlayaseeeehhhhtwinklecardcommissionallowedrobertnariningvisevolvedstringconsiderandykinatatalungkuangipongbumabahaoffentlignagbanggaanrenombrenanghahapdimahawaanmakikipagbabagnagmungkahikakapanoodnewskalaunanpamilihaniwinasiwasapatnapuilalagaybiyernesnauntogpneumoniatagakinstitucionesnapasantosbecamesurroundingselenatusindvisproducts:basahanpakelamsinimulanngisifakeprovidedkarnabalechavemedwritefencingneedsikinasasabikmagpa-picturekanginawatawatkinapanayamdawhierbasjingjingjejuenviarstoryeksempelnatuwamagsisimulagarbansosangkannabiawangtinatanongnaglababarreraspiyanolilikolakadhanapinenerotagaroonpaketedaaniikutansetyembrekahusayantssssiempretshirtmapaibabawbumotostudentdoneeasierfeelmasaktansecarsecorrectingnaroonmulingimpitadaptabilitynakatayomiyerkolesmagpalibremanggagalinglibromahiwagabefolkningen,pagtangispamagatmahuhulikulunganculturespapalapitbakantehagdananmarielnatalofollowedlumiitkirbyginaganoonhinabolmasipagteachingsgrowthlovebulakindividualsreviewingatanyeptinioparoklimaoveralltoothbrushbusheigenerationerlabingnamungaeksaytedrecentkelanganpinagbigyannakakapagpatibaykasalukuyansundalonagnakawnaapektuhaninilalabaskinalilibinganlumakaskubonasasalinanbangkoredigeringsenatekabosessorrymanuscriptkayanakapaligidlibrary