Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "charitable"

1. A portion of the company's profits is allocated for charitable activities every year.

2. Acts of kindness, no matter how small, contribute to a more charitable world.

3. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

4. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

5. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

6. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

7. He set up a charitable trust to support young entrepreneurs.

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. Her decision to sponsor a child’s education was seen as a charitable act.

10. His charitable nature inspired others to volunteer at the local shelter.

11. His speech emphasized the importance of being charitable in thought and action.

12. Many charitable institutions rely on volunteers to sustain their programs.

13. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

14. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

15. She donated a significant amount to a charitable organization for cancer research.

16. She joined a charitable club that focuses on helping the elderly.

17. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

18. The awards ceremony honored individuals for their charitable contributions to society.

19. The billionaire was known for his charitable donations to hospitals and schools.

20. The charitable donation made it possible to build a new library in the village.

21. The charitable organization provides free medical services to remote communities.

22. The church organized a charitable drive to distribute food to the homeless.

23. The concert raised funds for charitable causes, including education and healthcare.

24. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

25. The foundation's charitable efforts have improved the lives of many underprivileged children.

26. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

27. They organized a marathon, with all proceeds going to charitable causes.

Random Sentences

1. Magkita tayo bukas, ha? Please..

2. Pag-akyat sa pinakatuktok ng bundok.

3. Birthday mo. huh? Pano niya nalaman birthday ko?

4. Sa aking silid-tulugan, natatanaw ko ang ganda ng buwan na sumisilay sa bintana.

5. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

6. Halos gawin na siyang prinsesa ng mga ito.

7. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

8. The culprit who stole the purse was caught on camera and identified by the victim.

9. Pati ang mga batang naroon.

10. Pinagmasdan ko sya habang natutulog, mukha syang anghel...

11. Pumupunta siya sa Maynila bawat buwan.

12. A caballo regalado no se le mira el dentado.

13. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

14. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

15. Kumakanta kasama ang Filipino Choir.

16. Ang mailap na pagkakataon ay kailangan hanapin sa kung saan-saan upang hindi ito masayang.

17. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

18. Limitations can be physical, mental, emotional, financial, or social.

19. Los powerbanks son una solución práctica y conveniente para mantener los dispositivos electrónicos cargados cuando se está fuera de casa.

20. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

21. Ang saya saya niya ngayon, diba?

22. Mababa ang marka niya sa pagsusulit dahil hindi siya nakapag-aral.

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

25. Dapat nating isaalang-alang ang mga posibilidad ng bawat desisyon, datapapwat ay hindi natin alam ang mga mangyayari sa hinaharap.

26. All these years, I have been learning to appreciate the present moment and not take life for granted.

27. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

28. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

29. A couple of candles lit up the room and created a cozy atmosphere.

30. Ang tubig-ulan ay isang mahalagang bahagi ng siklo ng tubig sa kalikasan.

31. Hindi niya alam kung paano niya haharapin ang buhay na nag-iisa.

32. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

33. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

34. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

35. Nakahug lang siya sa akin, I can feel him..

36. I have graduated from college.

37. Ako ay nagtatanim ng mga halaman sa aking bakuran.

38. Teka, pakainin na muna natin sila. ani Jace.

39. Hey! Wag mo ngang pakealaman yan! sigaw ko sa kanya.

40. Siya ay isang masipag na estudyante na pinagsisikapan ang kanyang pag-aaral para makamit ang mataas na marka.

41. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

42. Jakarta, ibu kota Indonesia, memiliki banyak tempat wisata sejarah dan budaya, seperti Monumen Nasional dan Kota Tua.

43. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

44. My favorite thing about birthdays is blowing out the candles.

45. Saka dalawang hotdog na rin Miss. si Maico.

46. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

47. Malapit na ang araw ng kalayaan.

48. He has painted the entire house.

49. Masaya akong pumasok sa silid-aralan dahil mahilig ako sa pag-aaral.

50. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

Recent Searches

charitablenagulattrueresortbinawiandiyoskonggeneratedquicklyulingtipidmichaeleasiernalasingsatisfactionshiftabledatatilgangmagbubungapulang-pulakahusayankalabawrememberisinasamaipakitanangyarimagkaparehopinuntahanibonsinapoksulokmayroongmasaholumanomadulasalampinakamagalingtagtuyotkaparehananlilimossakitnapakahabanapatulalamaasahanpunongkahoydennechildrenduonnakaupocompanyadvertising,pinagkaloobanipinauutangproducererisinaramaidnakarinigtingsaritapinagbigyanmallniyonbighaniikinagagalakreachroonexpressionspusingngpuntakaramihanabutangearpagkaawanakitulogestosbabebumilipaghalakhakalagangsuwailbalatdreamnanamannagbabakasyontumakaspamanwakasheartbeatdisyempreasokundiman00ampampagandamakauuwikangitanmarianmawalapagkabataprincemagbaliknapadaanrelativelysiembramagitingirogmatabamuchpepemaskbalediktoryankutodmagsusunuranhagdanallottednakuhahiwagadrinkslumindolsolidifylabasfrescobilingpinalayaspaskongsinghalmakukulaymatalikhinimas-himasillegalbumabagsabogpriestkanilapagbatielenaibinentareservesninumanmabibingibilibidtumalimvidtstraktbutiarbejdsstyrkekamakailanindividualpananakitkonsultasyontradisyonpersonbrasokaninakayanakatunghaypagtatanongopisinahinamakmedya-agwatravelerbutasmakapangyarihangpapaanonamumulaklakrealroseboksingmagkasamamasaktanlossiskomaranasanamuyinherelunesbinatilyospeednangangahoysinkrealisticstonehamwowikukumparamagbabalangingisi-ngisingalbularyoexecutivemalagolamanpondopootnaglarobilihinprogramadecreasedhinanaprepresentedtabainiisipmaistorbo