Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "charitable"

1. A portion of the company's profits is allocated for charitable activities every year.

2. Acts of kindness, no matter how small, contribute to a more charitable world.

3. Being charitable doesn’t always involve money; sometimes, it’s just about showing kindness.

4. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

5. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

6. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

7. He set up a charitable trust to support young entrepreneurs.

8. Her charitable spirit was evident in the way she helped her neighbors during tough times.

9. Her decision to sponsor a child’s education was seen as a charitable act.

10. His charitable nature inspired others to volunteer at the local shelter.

11. His speech emphasized the importance of being charitable in thought and action.

12. Many charitable institutions rely on volunteers to sustain their programs.

13. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

14. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

15. She donated a significant amount to a charitable organization for cancer research.

16. She joined a charitable club that focuses on helping the elderly.

17. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

18. The awards ceremony honored individuals for their charitable contributions to society.

19. The billionaire was known for his charitable donations to hospitals and schools.

20. The charitable donation made it possible to build a new library in the village.

21. The charitable organization provides free medical services to remote communities.

22. The church organized a charitable drive to distribute food to the homeless.

23. The concert raised funds for charitable causes, including education and healthcare.

24. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

25. The foundation's charitable efforts have improved the lives of many underprivileged children.

26. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

27. They organized a marathon, with all proceeds going to charitable causes.

Random Sentences

1. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

2. Kahit na magkaiba kami ng wika, naging magkaibigan pa rin kami dahil sa aming kaulayaw sa isa't isa.

3. Nagluto ako ng adobo para sa kanila.

4. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

5.

6. Di ko rin alam kung ano na nga bang nangyayari.

7. Hulyo ang kaarawan ng nanay ko.

8. Over-emphasis can be counterproductive and may undermine the intended message.

9. Nasa kumbento si Father Oscar.

10. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

11. Ang pagpapalinis ng ngipin ay mahalaga para maiwasan ang mga sakit sa bibig.

12. The authorities were determined to find the culprit responsible for the environmental damage.

13. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

14. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

15. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

16. La tos nocturna puede ser un síntoma de enfermedades respiratorias como el asma y la apnea del sueño.

17. Tumayo siya tapos nagmadaling pumunta sa cr

18. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

19. Sa gitna ng kaguluhan, natagpuan niya ang kapayapaan sa pag-iisa.

20. Natutunan ng mga mag-aaral ang talambuhay ni Melchora Aquino bilang isang "Ina ng Himagsikan."

21. They do not eat meat.

22. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

23. Magdamag kong naiwang bukas ang ilaw.

24. Cutting corners on food safety regulations can put people's health at risk.

25. Hindi sila makaangal sa di makatarungang pagpapautang.

26. Jeg har lært meget af min erfaring med at arbejde i forskellige kulturer.

27. Siya ang aking pinakamatalik na kaulayaw sa opisina.

28. They have sold their house.

29. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

30. Isa sa mga paboritong routine ni Carlos Yulo ay ang floor exercise, kung saan madalas siyang mag-uwi ng medalya.

31. Ah miss, tanong lang... Iyo bang lahat yan?

32. Ano-ano ang mga nagbanggaan?

33. Ang pangalan ni Rizal ay itinuturing na sagisag ng pambansang identidad at paglaya sa Pilipinas.

34. Nagtatrabaho ako sa Youth Center.

35. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

36. You can always revise and edit later

37. Uuwi kami sa Pilipinas sa Disyembre.

38. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

39. Gusto ko hong pumunta sa Pearl Farm.

40. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

41. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

42. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

43. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

44. ¿En qué trabajas?

45. When the blazing sun is gone

46. The flowers are not blooming yet.

47. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

48. At følge sin samvittighed kan nogle gange kræve mod og styrke.

49. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

50. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Recent Searches

betacharitablekasiyahanmagta-trabahosasakyanfeareskwelahannapabalitasharemasayang-masayabatamatangkadisanggrowthhinaboldrayberminabutitanggalinmamanhikanpinaulananmarchiniinommag-alaskirotweddingnasagutanewanmag-alalaleveragewealthdyipnisukatprofoundbaclaranbinilingctricasasiaticnaglalakadincidencesinampal1920spagapangmaisdeterioratemaghandaflaviokabundukanbeseszoomnapabuntong-hiningagayapagkakatuwaanhinipan-hipantubignasiragusting-gustosangkalanfacemasktatlumpungnagkasunogreceptorpinapasayahinimas-himasmorningeffektivtkulotlenguajeo-onlinemabihisanpagsubokmamalasknowbehalfgiyeraginawaranpinangaralanjejukababalaghangboyfriendtelecomunicacionesnaantigservicessandalingmangkukulammaayossandwichmagpakaramikartonnatagalancubiclekumatokplasanakatindignamulabudokpinaggagagawacomplicatedandamingcharmingmaagapanmagkasakitputahebowcornermagdaraoskanilanginantokpwedepagpapatubokinikitamaglalakadnakakadalawnagpapaniwalanagtagisanpotaenakinasisindakanmagkaparehonagsasagotdisenyongnagsisigawnagpapakainnagkakakainmumuramagpalibremangangahoynagpaiyakumilingtinayseguridadnalamanpagpanhikcrucialisulatkisshumahangosdadalawinnaabutanchumochostilgangnitonakatiradilawkanginamagtatanimjingjingnaaksidentehinahanapninanaiskomedorbyggettindataglagaspaglalabatelebisyonbinentahanindustriyacosechar,nanamanbarreraspadalasliligawannapakabilistumatawadeksempelnapilisalbahemagandangdumilatmakatihanapinlakadpesoconclusion,bahagyangpromiseniyoescuelaspagsusulatprotegidosteamshipsferrerawitanhapag-kainandevicesincreasinglycoughingkakayanannatuloykinalimutantataasanubayanbanknakakapuntaretirarcitylilipadpampagandapagkabiglaiigibmusicians