Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "actor"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

3. El actor hizo un comentario controversial que está llamando la atención de los medios.

4. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

5. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

6. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

7. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

8. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

9. The actor received a hefty fee for their role in the blockbuster movie.

10. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

11. Tom Hanks is an Academy Award-winning actor known for his roles in movies like "Forrest Gump" and "Saving Private Ryan."

12. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

Random Sentences

1. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

2. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

3. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

4. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

5. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

6. The credit check for the apartment rental revealed no red flags.

7. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

8. La novela produjo una gran empatía en el lector hacia los personajes.

9. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

10. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

11. Doa dapat membantu seseorang untuk memperkuat keimanan dan menenangkan hati.

12. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

13. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

14. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

15. Inalagaan si Maria ng nanay niya.

16. He served as the 45th President of the United States from 2017 to 2021.

17. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

18. Ano ang suot ng mga estudyante?

19. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

20. Napakasipag ng aming presidente.

21. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

22. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

23. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

24. Sino ang doktor ni Tita Beth?

25. Il fait beau aujourd'hui, n'est-ce pas?

26. She enjoys drinking coffee in the morning.

27. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

28. Anong karangalan ang ibinigay sa kanya?

29. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

30. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

31. Stop beating around the bush and tell me what's really going on.

32. Dahil sa kanyang matapang na pagtindig, naligtas niya ang mga pasahero sa agaw-buhay na sitwasyon.

33. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

34. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

35. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

36. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

37. Mahirap hanapin ang katotohanan sa kaibuturan ng kaso.

38. Humihingal na rin siya, humahagok.

39. Noong una, sinasagot niya ang mga panunuksong ito.

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

42. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

43. Saan nakatira si Ginoong Oue?

44. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

45. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

46. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

47. Satu titik hitam bisa merusak noda yang putih.

48. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

49. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

50. The United States has been involved in many international conflicts, including World War I and World War II.

Similar Words

factores

Recent Searches

actorbaldedosmonetizingnotebookamazonimprovedinternetexitconnectionnakakaanimmagdamaganibinaonmakinangbalatganoonnananaghilitreatsownprimerosbugtongwellmagagalingo-orderkokakcoaching:polocheckstumalonpahirapanatagiliranonline,tinahakeuropegawaingumabotmataasmalumbaydiseaseskatutuboyongopisinasiguromalambingbasahinpunongkahoynagmakaawathankwantspiritualanywheretawadpostermagbabakasyongasolinahanhanconventionalniyonlaybrariogorpalantandaanbabespartmagpaniwalamagkakaanakpagkamanghanakatuwaangnakakatawanakabulagtanglaki-lakinag-oorasyonpinagmamalakiagwadorpinakamaartengfinalized,batomagtiwalahouseholdsbumisitanagdiretsonakapasokuusapanmagkaibangnagsisigawmakitasalepanghihiyangikinalulungkotkinagalitannakalockhululumibotkaklasekulunganitinatapatmahiwaganamataypangungusapibinilibrancher,guitarranakakatabapanalanginibinubulongmamayangmakapilingkaratulangkapitbahaypictureskampeonkristokulturpapuntangsisikatnapilipatawarinnangapatdanintramurosnakilalakabiyakpamagatnatayoexperience,maskinermatutongsahiglilikodiliginbibilhinpangakokapatagankarapatangpinabulaanna-curiousguerreropapalapitnapapatingintsinelasmaubosbutiilagayinastagjortforskeleksportenjagiyanatuloypinilitnovembercashsisipainkongresonunomaya-mayahikinghverkinainhomesbukasinimbitasandalinyannenapinalitanlenguajesurroundingsmatesasocialemaliitsigenapatingalafonosfionahojashouse00amdahaniatfskypegraphicbigoteparangnaggalamartescryptocurrencyboksingtools,yelobumababacongressplaceipanlinisjokemisaleukemiabarrocopagodcanadaespigasinyo