Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "pinauwi"

1. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

2. May meeting daw ang lahat ng guro kaya't kami ay maagang pinauwi.

Random Sentences

1. Teka bakit dinala mo ako dito sa labas?!

2. Nasa Pilipinas na si Raymond ngayon.

3. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

4. Nakita ng mga ibon si Paniki at tinanong siya kung bakit siya asa kanilang kampo samantalang isa naman daw siyang mabangis na hayop.

5. Ha? Ano yung last na sinabi mo? May binulong ka eh.

6. Sí, claro, puedo esperar unos minutos más.

7. Nous avons réservé une salle de réception pour la célébration.

8. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

9. Dumadating ang mga guests ng gabi.

10. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

11. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

12. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

13. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

14. No te preocupes, estaré bien, cuídate mucho y disfruta de tus vacaciones.

15. It is important to have clear goals and expectations in the workplace.

16. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

17. Omelettes are a popular choice for those following a low-carb or high-protein diet.

18. Ang mga kliyente ay inaanyayahan na magbigay ng kanilang mga mungkahi upang mapabuti ang serbisyo ng kumpanya.

19. It is an important component of the global financial system and economy.

20. Mathematics is an essential tool for understanding and shaping the world around us.

21. El cambio de gobierno produjo una reorganización completa de las instituciones.

22. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

23. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

24. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

25. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

26. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

27. Ang kundiman ay nagpapaalala sa atin ng mga halaga ng pagmamahalan at pagka-makabayan.

28. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

29. Motion kan også hjælpe med at reducere risikoen for visse sygdomme, såsom type 2-diabetes, hjertesygdomme og visse former for kræft.

30. Paki-basa po ang kuwento para sa akin.

31. Pwede ko ba malaman ang password ng inyong wifi?

32. Nang bumukas ang kurtina, lumiwanag ang entablado.

33. Nakakalunok siya nang malalim at maririnig mo ang kanyang halinghing.

34. Nanghiram ako ng bicycle para sa isang bike race.

35. Magkano ang arkila ng bisikleta?

36. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

37. Emphasis is an important component of artistic expression, such as in poetry and music.

38. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

39. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

40. Iba ang landas na kaniyang tinahak.

41. Hinalungkat na niya ang kahong karton na itinuro ng ina.

42. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

43. Money can be saved and invested to achieve financial goals and build wealth.

44. Aalis na nga.

45. Marahil anila ay ito si Ranay.

46. We admire the dedication of healthcare workers in the midst of the pandemic.

47. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

48. We have seen the Grand Canyon.

49. Einmal ist keinmal.

50. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

Recent Searches

pinauwitinungovaccineshinalungkatisasamamangingisdangnakauslingnagtaposginawangmagbigaybayadlugawkaraokegroceryniyonemocionalsaktanpasaheparusahankutsilyoidiomabarangaypalitankuboctricasmaligayakanilafatheradditionally,sinakopmangingibigipinamilicareerpagdamijobdisyembretalentrestaurantpaksanataposwastesagapmagbigayanapatkalaunansupilinexhaustedvelstandhmmmbingbingpataynagpuntasetyembremanuscriptkainmenosblusangamparocasadaladalaassociationbeginningsnatingalapagbahingpocadalandanlargercriticsroomshowsbinigayinalisofteinalokdrewchessstonehamsumakitbeintesumugodmagnanakawsecarseslavehimselfclientesfurtherupworkipinagbilingdaigdigpracticadopopularandroidformshateevolvedipinalitbatamultogenerationsalignspusongalwaysnakakatulongnagpaiyaknag-usapstrategiesmangangalakalkulturmatagalgawingtumawapagpanhikvitaminmuchas1960shumblesaboghetonitonakabalikimportantesrhythmsimplengtablealitaptapnagaganapatensyongkikitajoedahilmaliksinakitulognagwalispahabolnapapikitelectsinimulanretirarinilistastudentnawalanakaakyatirogreplacedsaynaliligoshiftkalikasanconsistnakapagreklamovalleyyoutubeiparatinghinimas-himaspinakamaartengnamumulaklakculturepambahaykaharianpagtutolnaguguluhannagmadalingnakuhangdahan-dahanrevolutioneretanyolumalakikadalagahangkonsentrasyonnapakatagalkalalakihannagsisipag-uwiannagtutulungancontinuespanghihiyangpagtatanongkinabubuhaymagbayadtuluyanclubpalabuy-laboypagngitinamataykwenta-kwentalabinsiyambwahahahahahanangyarilandlinepahiramactualidadmasaksihanmabihisanbutikikaramihanumigtadpuntahanmakawalatrycyclemaibibigaynagpaluto