Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "science"

1. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

2. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

3. La physique est une branche importante de la science.

4. La science a permis des avancées significatives dans la médecine.

5. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

6. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

7. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

8. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

9. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

10. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

11. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

12. La science est la clé de nombreuses découvertes et avancées technologiques.

13. Les archéologues utilisent la science pour comprendre les cultures du passé.

14. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

15. Les mathématiques sont une discipline essentielle pour la science.

16. Mathematics has many practical applications, such as in finance, engineering, and computer science.

17. Microscopes are also used in materials science and engineering to study the microstructure of materials.

18. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

19. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

20. Television is one of the many wonders of modern science and technology.

21. They have been studying science for months.

22. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

23. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

2. Sa gitna ng pagkabigo, hindi maiwasan ang paglabas ng malalim na himutok.

3. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

4. Pero salamat na rin at nagtagpo.

5. Scientific discoveries have revolutionized our understanding of genetics and DNA.

6. Bumili si Ryan ng pantalon sa palengke.

7. Mayroong proyektor sa silid-aralan upang mas maipakita ang mga visual aids sa pagtuturo.

8. Lumungkot bigla yung mukha niya.

9. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

10. Dapat mong namnamin ang tagumpay na iyong pinaghirapan.

11. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

12. Kanino ka nagpatimpla ng cocktail drink?

13. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

14. Sino ang maghahatid sa akin sa pier?

15. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

16. Eh? Katulad ko? Ano ba ang isang tulad ko?

17. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

18. Modern civilization is based upon the use of machines

19. Sinabi naman ni Apollo ang mga dapat gawin.

20. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

21. Nagtanim ng puno ang mga boluntaryo nang limahan.

22. He has fixed the computer.

23. La obra social produjo una gran ayuda para los más necesitados.

24. Salamat at hindi siya nawala.

25. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

26. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

27. At samantalang nakadapa, unti-unting nabuo sa walang malamang sulingan niyang mga mata ang mga paang alikabukin.

28. Ako ay nagtatanim ng mga halaman sa aking bakuran.

29. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

30. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

31. Nariyan sa kahon ang kamiseta mo.

32. Buenos días amiga

33. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

34. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

35. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

36. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

37. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

38. There are so many coffee shops in this city, they're a dime a dozen.

39. A wedding planner can help the couple plan and organize their wedding.

40. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

41. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

42. Pinaluto ko ang adobo sa nanay ko.

43. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

44. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

45. I'm on a diet, but I couldn't resist having a small slice of cake.

46. Sana maintindihan mo kung bakit ako nagagalit at nag-iinis sa iyo.

47. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

48. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

49. Napatingin ako sa kanya, Bakit naman?

50. Payapang magpapaikot at iikot.

Recent Searches

fanssciencelagikasingtoysampungmultotoollibrobasaneverkapangyarihannasilawpinilingnagpasanmahiyadrogatabisagutinmanuelsasabihinnasaangdasalsisikathabasustentadomakapaibabawmagsisimulagamitinnakakatawanaisnagpapakaintanawinkahaponpagkabiglaadikannikanagkikitaumanogovernmentbrancher,basuramaispangitdontbringlayuansinasabiflyprogramspare-parehonapakatalinomagkakailakinakitaanmagpa-ospitalwalkie-talkiepakikipagtagpokumembut-kembotnagtatanongnagmamadalinahawakanmagtanghaliannagpaiyakhouseholdskabuntisanpagtawaihahatidkatawangbestfriendpinakamahabanamumutlainsektongpoorerpaghahabiumakbayabundantepaghangamakakibopambatangleksiyonnabighanisang-ayonngunitmahuhulistayvidtstraktpananglawpeksmantaxiumiibighinahanapmagagamitgagamitmalalakihawaksangapakibigyannakainomkatolisismomahabolkumananbibigyandealnatakotmanalotinikmanxviilalopesoinangadecuadolangkaytomorrow1960sgigisinginventiontilimahigitagilatuvonataposyourself,edsaandressacrificecolornyansandalinapapatungoprinsipengreguleringpadabogkinainoposetyembrebalangpanindangbilibmataposiguhitbairdnapatingalaheheshopeesawavalleykiko1920spitakahamaksumamabativampiresmagdatuwangbroadcastlamesanahuhumalingfatdragonfloorabenemurangrhythmkwebangbumababaguardanagngingit-ngitumarawsummitdawparatingpotentialcornerboyseentalesecarseconnectionsulinganexpectations4thimagingbardaylivehelpfulincludesettingclocktableadaptabilitysystemmasterlutuincountlesssundhedspleje,kisapmatabumaligtadkare-kare