Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "science"

1. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

2. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

3. La physique est une branche importante de la science.

4. La science a permis des avancées significatives dans la médecine.

5. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

6. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

7. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

8. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

9. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

10. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

11. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

12. La science est la clé de nombreuses découvertes et avancées technologiques.

13. Les archéologues utilisent la science pour comprendre les cultures du passé.

14. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

15. Les mathématiques sont une discipline essentielle pour la science.

16. Mathematics has many practical applications, such as in finance, engineering, and computer science.

17. Microscopes are also used in materials science and engineering to study the microstructure of materials.

18. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

19. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

20. Television is one of the many wonders of modern science and technology.

21. They have been studying science for months.

22. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

23. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. Ano ang nasa bulsa ng bag niya?

2. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

3. Ang magulang na mabuti, ang anak na sumusunod.

4. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

5. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

6. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

7. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

8. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

9. Masama ho kasi ang pakiramdam ko.

10. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

11. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

12. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

13. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

14. He has bigger fish to fry

15. Joshua, kumusta ang pakiramdam mo?

16. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

17. Don't beat around the bush with me. I know what you're trying to say.

18. I am reading a book right now.

19. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

20. La realidad es que las cosas no siempre salen como uno espera.

21. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

22. Pangkaraniwang Araw sa Buhay ng Isang Tao

23. Amazon started as an online bookstore, but it has since expanded into other areas.

24. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

25. El ajedrez es un pasatiempo que disfruto desde niño.

26. Nationalism can have a positive impact on social and economic development.

27. Bawal magpakalat ng mga pekeng balita dahil ito ay maaaring makapagpahayag ng maling impormasyon.

28. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

29. Electric cars can help reduce dependence on foreign oil and promote energy independence.

30. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

31. Malulungkot siya paginiwan niya ko.

32. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

33. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

34. Nanalo siya ng isang milyong dolyar sa lotto.

35. Basta may tutubuin ako, lahat ay areglado.

36. Nakikita mo ba si Athena ngayon?

37. Salamat po at pinagbigyan nyo ako.

38. Mahiwaga ang espada ni Flavio.

39. They are not shopping at the mall right now.

40. Stop beating around the bush and tell me what's really going on.

41. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

42. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

43. Has she written the report yet?

44. Dahil sa kahirapan natuto siyang magnakaw at mandukot

45. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

46. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

47. Dahan-dahan niyang iniangat iyon.

48. Sino ang maghahatid sa akin sa pier?

49. Ibinenta ni Mang Jose ang karne kay Katie.

50. Nagtitinda ang tindera ng mga prutas.

Recent Searches

inalalayanscienceyumabongmakakakaengumagalaw-galawnapakamisteryosomagagandangkaloobangmakahirampresidentialkasapirinpamburapinagsikapankinamumuhianpagpilierlindaeconomysinalansandisfrutarmagagamitsharmainehandaanpagguhitberegningernakakaanimpakakasalannaawatumingaladisensyosisikatnaminpangalanantransportmusicalutilizamenoskagayamalihisflavioyourself,10thnakatira18th1980searchsaananothercomputeremotioncallclientesaffectconvertingkainiscashsimuleringerbiniligreatlynag-alalakelansahignaglaonmanggamanuscriptpinagsanglaanjobhinintayroboticdawcakesaranggolanagagandahannakakapamasyalimpornakatindigactualidadnapaluhabumisitabalitanatuwapagamutanalapaapregulering,isinaboymarketing:ipinauutangnaabotsakalingnapadpadnatutulogconclusion,kahalumigmigannagkapilatnagbentaprovidedginamotnakaupoarkilafriendpalakataasnilulonbingosinampalfilmshacernapadaaneleksyontalentsundaeiconsoverviewbringingdailyfrescomedicineipapainitadicionaleslingidharapcountryschoolmagdilimmuntikantermcinebodamahinoghalamananmadadalakailangangmag-anakbinasafertilizerasindiplomaplatformgapuponadobohinaundaskundimaasimmalungkotpamasaheyatapersonsinasakyandolyarmakilingkarwahengbopolsteknologionlineperohinagud-hagodnangampanyananghihinamadnangagsipagkantahannangahasfilipinakakatapospaki-chargekapasyahanparehongtreatskapamilyasalenagpabayadrenombremagasawangditootrasiniindakinumutankamandagmagbibiladbwahahahahahanakakainumabotmasungitbasketballbuhawide-latamarangalrespektivemusicpapayadepartmentika-50kagipitanmagselosgawaingperyahantig-bebeintedispositivopaglulutotinahakkasi