Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "science"

1. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

2. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

3. La physique est une branche importante de la science.

4. La science a permis des avancées significatives dans la médecine.

5. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

6. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

7. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

8. La science des données est de plus en plus importante pour l'analyse et la compréhension de grandes quantités d'informations.

9. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

10. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

11. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

12. La science est la clé de nombreuses découvertes et avancées technologiques.

13. Les archéologues utilisent la science pour comprendre les cultures du passé.

14. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

15. Les mathématiques sont une discipline essentielle pour la science.

16. Mathematics has many practical applications, such as in finance, engineering, and computer science.

17. Microscopes are also used in materials science and engineering to study the microstructure of materials.

18. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

19. Si Maria ay mahusay sa math, datapwat hindi siya mahilig sa science.

20. Television is one of the many wonders of modern science and technology.

21. They have been studying science for months.

22. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

23. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

Random Sentences

1. Me gusta salir a caminar por la ciudad y descubrir lugares nuevos, es un pasatiempo muy entretenido.

2. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

3. Lumitaw ang bungang-araw niya sa likod at leeg.

4. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

5. At naroon na naman marahil si Ogor.

6. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

7. Einstein's writings on politics and social justice have also had a lasting impact on many people.

8. Hindi na niya narinig iyon.

9.

10. Omelettes are a popular choice for those following a low-carb or high-protein diet.

11. Ang lakas ng sagap ng wifi sa kanilang bahay.

12. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

13. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

14. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

15. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

16. Na parang may tumulak.

17. Sino ang mga pumunta sa party mo?

18. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

19. ¿Cómo te va?

20. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

21. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

22. Gusto kong maging maligaya ka.

23. Balancing calorie intake and physical activity is important for maintaining a healthy weight.

24. Pumunta si Trina sa New York sa Abril.

25. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

26. Ang bilis natapos ng palabas sa sinehan.

27. Naramdaman ko ang kanyang halinghing sa aking tainga dahil sa sobrang lalim ng kanyang paghinga.

28. All these years, I have been blessed with the love and support of my family and friends.

29. Matitigas at maliliit na buto.

30. They are cooking together in the kitchen.

31. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

32. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

33. Bahay ho na may dalawang palapag.

34. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

35. Hindi po ba banda roon ang simbahan?

36. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

37. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

38. Ipinabalot ko ang pakete sa kapatid ko.

39. Gusto ko na talaga mamasyal sa Singapore.

40. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

41. Ang hirap naman ng exam nakaka bobo.

42. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

43. Tumayo siya tapos humarap sa akin.

44. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

45. Limitations can be physical, mental, emotional, financial, or social.

46. The decision to release the product early was a risky but ultimately successful strategy.

47. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

48. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

49. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

50. Hello. Magandang umaga naman.

Recent Searches

scienceknightdinanassaan-saantapeulingrefaffectlibrogitnamaniwalamahiyatuwamahahabapumayaghabanganumancanadanaroonpoliticalfulfillmentnag-replydispositivosinfusionesmagta-trabahohalu-halodreamsaregladomag-usappandalawahannahulaanminamasdanrichnag-asaranhinacallerthesehanginkahuluganhallipaliwanagpisarasoundpagpapasakitperfectbanalpowerhaponaudio-visuallypyestateachnahuhumalingwaringenchantediniskamag-anaknagsisihankilalang-kilalaasulrolledmakikiligobangkadrawingtipidsettingipinagdiriwangsweetnagnakawbungabagokamatissusundogrammarnakasuotiatfskypeparosaanyepbairdmeaningmapaibabawbukodfacilitatingclassroompartnerballgenerationernakatunghaynamumulaklaktambayanexcitedtuluyanmanggagalinghila-agawankonsultasyonbumisitaeconomynamumulotkapagbefolkningen,paghihingalopanghihiyangmagpagalingnanlalamiginsektongimporphilanthropyhumiwalayhealthmananakawpanalanginkatuwaanibinibigaynauliniganmakikitulogtemparaturanakatindigpagkasabifitnessabundantebwahahahahahasumusulatumakbaylinggongnalangtindahanhigantedadalawtahanankaramihanrequiereniikotantokalangannararapatkirbydecreasedbagalnamannapasukoindiadailykontingahassusiautomaticagefacultytandamabutingwidekwebanglawsglobalmagkanodasalpanginoontaoapelyidolayuninhumahangosnag-oorasyonginawapinatirakwartonagsipagtagosobrangmananahipagigingharapanmakasilongmakalipasmagpakasalcompositorestransportationbumuhossumimangotgayunpamanmaliitmatagalnakaliliyongmakakalimutinnakukulililumiwanagfollowing,dadalawinkapangyarihanghubad-baronaghihikablingidhumaloalwayspangangatawanambisyosangwakastumambadkulognaglaonnagsidalo