Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "friends"

1. A couple of friends are coming over for dinner tonight.

2. A couple of friends are planning to go to the beach this weekend.

3. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

4. All these years, I have been blessed with the love and support of my family and friends.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

7. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

8. He plays chess with his friends.

9. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

10. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

11. I love to celebrate my birthday with family and friends.

12. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

13. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

14. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

15. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

16. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

17. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

18. My friends surprised me with a birthday cake at midnight.

19. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

20. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

21. She burned bridges with her friends by spreading gossip about them.

22. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. They have been friends since childhood.

25. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

26. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

27. Weddings are typically celebrated with family and friends.

28. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

2. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

3. Gracias por todo, cuídate mucho y nos vemos pronto.

4. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

5. Ano pa ho ang dapat kong gawin?

6. Bigyan mo ng pera ang pulubi.

7. Beth ang pangalan ng matalik kong kaibigan.

8. Isang Pinoy ang nanalo sa international singing competition.

9. Tendremos que tener paciencia hasta que llegue nuestro turno.

10. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

11. Saan nangyari ang insidente?

12. Anong gusto mo? pabulong na tanong saken ni Maico.

13. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

14. Psss. napatignin ako kay Maico. Naka-smirk siya.

15. Gaano ka kadalas uminom ng bitamina?

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

18. Kumain ka ng gulay upang maging malusog ka.

19. Cuídate mucho de esas personas, no siempre son lo que parecen.

20. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

21. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

22. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

23. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

24. Isasama ko ang aking mga kapatid sa pamanhikan.

25. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

26.

27. Sige, oo na lang tayo kahit sa totoo lang, ang baduy.

28. Naglalambing ang aking anak.

29. "The better I get to know men, the more I find myself loving dogs."

30. Las noticias en línea pueden ser actualizadas en tiempo real.

31. Mathematics can be used to analyze data and make informed decisions.

32. Kantahan mo si Noel ng Kumanta ka ng kundiman

33. She carefully layered the cake with alternating flavors of chocolate and vanilla.

34. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

35. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

36. They organized a marathon, with all proceeds going to charitable causes.

37. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

38. Ok ka lang ba?

39. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

40. The title of king is often inherited through a royal family line.

41. Ang kaniyang pagsasalaysay ay animo'y isang makulay na kuwento mula sa isang librong mahirap kalimutan.

42. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

43. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

44. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

45. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

46. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

47. The new restaurant in town is absolutely worth trying.

48. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

49. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

50. Tara na nga Hon! Mga baliw ata yan eh!

Recent Searches

friendskarapatanpaulit-ulitamerikaisugatoypaatabinggaphallagosemailhighestcurrentnakiramaybituinpagpapatubomakapaibabawgobernadornagmamaktolhinagud-hagodculturananghihinamadnagsusulatmagbabagsikmakidaloiintayineconomypagkapasoknahawakanpagkuwajobspagpapautangmakangitihubad-baropagpapasanmagpaliwanagkapangyarihanpagtiisanmusicianmagasawangmag-asawanamulaklaklumalakipinagalitannagpapakainmagkakagustomang-aawitmanlalakbayressourcernenakaka-incrucialpagtataasmagpapagupitnakapasoknagmistulangnakatulognakatapatmahihiraphampaslupapupuntahanbestfriendkapamilyanakayukonapakasipagencuestastinakasantemparaturapinagawapandidiripaki-chargebisitalalakinananalongnagcurvepaki-drawingtumagalbusinessespinuntahanmagtagoyumuyukomagpahabatindaintensidadhawaiiengkantadangsabihinlumakaspamasahekayabanganhalu-halomaipapautangnareklamopag-itimsuzettepundidoumiibignamuhaypaninigastumaposnabuhayedukasyonintramurosnagsinenagbibiromusicaleskumirotnakabibingingkumpletomayrecordedinilingtakembricosmabigyanlikodkamalianpanginoonna-curiousmahahawatamarawnationalbahagyapapuntangisusuotbinuksansignalkatagangtatlongmatangkadbantulotkaninagawaaustraliaipinangangaksisentapananakitbumalikgusalibayaniitinaassandalingtawanewspapersanumanbaguiokumustatondoturonarabiananoodumibiganilamatalimligaligpamanbagalhotelarteangalbaryomaonglipatdespueskenjibilanggobutitsinelasmatikmankainisnochemejoumaagosbumabagdailysonidobumotobuenapangalanbangkosumasakitknightparurusahanayawkriskagardenbangkongnobodygivemerryfionaredigeringscottishnakasuotgoodeveningpalagibotantearguepresyoitutol