Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "friends"

1. A couple of friends are coming over for dinner tonight.

2. A couple of friends are planning to go to the beach this weekend.

3. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

4. All these years, I have been blessed with the love and support of my family and friends.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

7. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

8. He plays chess with his friends.

9. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

10. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

11. I love to celebrate my birthday with family and friends.

12. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

13. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

14. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

15. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

16. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

17. Many people exchange gifts and cards with friends and family during Christmas as a way of showing love and appreciation.

18. My friends surprised me with a birthday cake at midnight.

19. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

20. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

21. She burned bridges with her friends by spreading gossip about them.

22. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

23. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

24. They have been friends since childhood.

25. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

26. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

27. Weddings are typically celebrated with family and friends.

28. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

2. Walang bagay na di makita at agad tinatanong ang kanyang ina.

3. Ang aming koponan ay pinagsisikapan na makuha ang kampeonato sa darating na liga.

4. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

5. The company suffered from the actions of a culprit who leaked confidential information.

6. Players move the ball by dribbling, passing, or shooting it towards the basket.

7. Bumili ako ng pasalubong sa tindahan kahapon.

8. Sa isang pagamutan ng pambansang bilangguan sa Muntinlupa ay makikita ang apat na lalaking may kanya-kanyang karamdaman

9. Have they visited Paris before?

10. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

11. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

12. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

13. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

14. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

15. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

16. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

17. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

18. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

19. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

20. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

21. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

22. Ang alin? iyamot na sabi ko habang nakapikit na.

23. Road construction caused a major traffic jam near the main square.

24. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

25. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

26. Sa gitna ng kaguluhan, natagpuan niya ang kapayapaan sa pag-iisa.

27. Gusto ko na umuwi ng Pilipinas.

28. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

29. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

30. Pinabulaanang muli ito ni Paniki.

31. Hindi na sila nasisiyahan sa nagiging asal ng bata.

32. Wag ka naman ganyan. Jacky---

33. See you later. aniya saka humalik sa noo ko.

34. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

35. El nacimiento puede ser un momento de alegría y emoción para la familia, pero también puede ser estresante y desafiante.

36.

37. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

38. Nagsimula ang programa sa dakong huli ng gabi.

39. Les étudiants doivent respecter les règles de conduite à l'école.

40. Her decision to sponsor a child’s education was seen as a charitable act.

41. The baby is not crying at the moment.

42. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

43. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

44. Ang pagtitiwala, ayon sa karanasan.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Kung napaaga ng tatlumpung segundo sana ang dating niya ay naabutan pa sana niya ang karwaheng sinasakyan nina Helena.

47. Nakapila ako sa bayad center upang magbayad ng kuryente.

48. I bought myself a gift for my birthday this year.

49. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

50. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

Recent Searches

tsakadikyamsikofriendsmalumbaykingmag-ingatugalicupidfueltoothbrushsamfundfeltgamotmulighedmesangpoloumingitnakalagaypagtayopagpapakilalaroqueinfinitywaitbetweenulodoingrequiremakapilingincludestringestablisheddisfrutarmakatatlocesmacadamiaencounterhariauditperacolouripinapasansumaliaraw-tayongtaasnangangalogpinasoklungkotmakatayokinabukasancommercialasalmagigitingmangsambitnabighaniinsektokumakantakumainbanawepagkaingiconictayobayangenergynakasusulasokroofstockreturneduuwikinamumuhianmulaipanghampasdawnariyanikinakatwiranamingdon'tnahulogkanyasayasubalitnagtagalnanlilimahidpangyayarimagtatagaljosefanapagtuunanbinawianmagbabakasyonnagdarasalscientistulapmahuhusaypagguhitdatungexperts,complexmagpa-checkupvelfungerendenakuhangexplaindisenyongproperlygaanonawalaspongebobminutovetoleksiyonleegcolorsumisidnagyayangasthmaskills,pinag-aaralanbagyopossiblediyantumatawagfigurasmaskilasingsystemhadlangnawalangnaglokominamadalinananalotungawibangnamulatnakikilalangnakatunghaypinagsikapanlaki-lakinapakalungkotmagsalitastaylumiwagmagagandangpamahalaanpagpapautangipatuloypinagalitankinapanayamkalakihannagpalalimkinikitamagnakawpaglalabatanghalipinagmamasdanpaumanhinkinakabahanpagpilikonsultasyoneskuwelatinangkainferiorespanghihiyangmagbabagsiknakayukokasikalalaromakakakaennalakiyoutube,nahintakutannapasobranagmistulangpagsisisih-hoymiyerkulesamericadiwatapagsahodtindapinapataposmagkasakitkanginagospelnaniniwalatangekskaharianandroidtiyakmahalnaiinismatumalpropesorcosechar,nahigitanpalamutisumalakaysukatinkamaomakaka