Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "energy-coal"

1. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

2. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

5. Dancing all night at the club left me feeling euphoric and full of energy.

6. Eating a balanced diet can increase energy levels and improve mood.

7. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

8. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

9. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

10. Electric cars can help reduce dependence on foreign oil and promote energy independence.

11. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

12. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

13. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

14. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

15. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

16. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

17. Not only that; but as the population of the world increases, the need for energy will also increase

18. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

19. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

20. Tesla is an American electric vehicle and clean energy company.

21. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

22. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

23. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

24. The scientific community is working to develop sustainable energy sources to combat climate change.

25. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nagtataka ako kung bakit ganito ang mga nangyayari sa mundo ngayon.

2. I can't believe how hard it's raining outside - it's really raining cats and dogs!

3. Hiram muna ako ng iyong kamera para kuhanan ang mga litrato sa okasyon.

4. To infinity and beyond! at binaba ko ulit yung telepono.

5. Siya ay nagiigib ng tubig sa banyo habang nag-aayos para sa trabaho.

6. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

7. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

8. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

9. Saya suka musik. - I like music.

10. Bumili si Ryan ng pantalon sa palengke.

11. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

12. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

13. Ang saya saya niya ngayon, diba?

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

16. Isang maliit na kubo ang nakatayo sa itaas ng baranggay, sa tagiliran mismo ng bundok na balot ng makapal na gubat.

17. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

18. The momentum of the wave carried the surfer towards the shore.

19. Con paciencia y perseverancia todo se logra.

20. They have been studying science for months.

21. Tinigilan naman ni Ogor ang panunukso.

22. Nangahas si Pedro na magnegosyo kahit walang sapat na puhunan.

23. Tinanong ng guro kung mayroon kaming mga katanungan ukol sa aralin.

24. Ang mahal na ng presyo ng gasolina.

25. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

26. Ano ang ginawa mo kagabi bago ka matulog?

27. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

28. Nandiyan po ba si Ginang de la Cruz?

29. Scarlett Johansson is a prominent actress known for her roles in movies like "Lost in Translation" and as Black Widow in the Marvel films.

30. Yumabong ang pagmamahal ng mga tao sa mga hayop dahil sa mga kampanya para sa kaligtasan ng mga endangered species.

31. Sa gitna ng katahimikan ng gabi, narinig ang panaghoy ng isang inang nawalan ng anak.

32. Bis morgen! - See you tomorrow!

33. Les enseignants peuvent organiser des activités parascolaires pour favoriser la participation des élèves dans la vie scolaire.

34. Naglaro sina Paul ng basketball.

35. La realidad nos enseña lecciones importantes.

36. Huwag magpabaya sa pagsunod sa mga patakaran at regulasyon sa trabaho.

37. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

38. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

39. Sa isang iglap siya naman ang napailalim.

40. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

41. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

42. They do not ignore their responsibilities.

43. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

44. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

45. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

46. Nag-iisa siya sa buong bahay.

47. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

48. Baka matunaw ako. biglang sabi niya. Langya gising pala!

49. Mahal niya pa rin kaya si Lana?

50. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

Recent Searches

energy-coalsalatpagdiriwangpinag-aralanpunofindeinalagaanwhateverkatolisismopawispaghangainyomatamanbinatomagkaibangnagugutommassachusettsnapaiyakcomplicatedscottishpangalanannakinignangagsipagkantahanmakasalanangcassandracadenanakakagalingipipilitapatnapunagniningningsana-allmagtipidnagpasyahehekelanproveparinailmentspangnangimpactedmalayangmemoriallumakaddumalawsufferhulingcubakarapatangicepananakoteverybadmakebarangaybinibilipag-aaralbaliwdreamsitinuturocompletingtawanakatinginnagpuntaindividualsbawatelectionssumigawlumagosinakopsilaamongsultankakayanangintsikedadmuchapaidngunitkampeonlunasadvancespusohetoclassroomkatulongcellphonepersonasbutihingsubalitskabthalu-halomataasskirtpulubilawakalawangingincreasedkinuskostangingboardmatapangdarkconclusionmagpasalamatiwanevolucionadogirisawang-awasasamahansabinapatawadkulotsumpunginpagtungoitinaobtopicbaomanipismakangitilegislationthanksgivingpayapangtaongpagkakatuwaankinahuhumalingantitopalayokmaglutoclockkumainsandalingkinabusogtiradorpaslitsagotmariaatentobasurangipinhitsurasaansanpanginoonano-anoworkshopt-ibangumuulaneconomicgandadapit-haponuulitpalabasnaiilaganownnaiswritingkamalayankaysinipangipongmasnagaganapkamingsyangmamasyalsamakatuwidatinpagodkuwartocontrolledpamilyaaksiyonpocakulaymakukulaynegativesipaganimalapitgalitpakisabimalapitanmismomaritesnanaysumasaliwkagandahanhayoplandaselijemarahilforcesdagattechniquespagmamanehounconventionalbesidesmungkahikaragatan