Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "energy-coal"

1. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

2. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

5. Dancing all night at the club left me feeling euphoric and full of energy.

6. Eating a balanced diet can increase energy levels and improve mood.

7. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

8. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

9. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

10. Electric cars can help reduce dependence on foreign oil and promote energy independence.

11. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

12. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

13. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

14. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

15. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

16. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

17. Not only that; but as the population of the world increases, the need for energy will also increase

18. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

19. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

20. Tesla is an American electric vehicle and clean energy company.

21. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

22. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

23. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

24. The scientific community is working to develop sustainable energy sources to combat climate change.

25. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Ailments are physical or mental health conditions that cause discomfort or illness.

2. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

3. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

4. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

5. Ang Biyernes Santo ay pagluluksa.

6. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

7. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

8. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

9. Tinulungan ko siyang dalhin yung mga plato sa dining room.

10. Kanina ka pa? tanong ni Aya sa akin.

11. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

12. Las hojas de mi cuaderno están llenas de garabatos y notas.

13. Hockey is played with two teams of six players each, with one player designated as the goaltender.

14. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

15. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. Sa ganang iyo, bakit hindi lahat ng tao ay pantay-pantay ang oportunidad sa buhay?

18. Malilimutin si Lolo kaya’t lagi niyang hinahanap ang kanyang salamin.

19. Omelettes are quick and easy to prepare, making them a convenient meal option.

20. La conciencia es la voz interior que nos guía hacia lo correcto y lo incorrecto.

21. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

22. Ang daming pulubi sa Luneta.

23. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

24. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

25. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

26. He's always telling tall tales, so take his stories with a grain of salt.

27. Hindi na nakita ni Aling Rosa si Pinang.

28. Pinili kong mag-aral ng Edukasyon upang maging guro din sa hinaharap.

29. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

30. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

31. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

32. Pag-akyat sa pinakatuktok ng bundok.

33. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

34. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

35. Las vacaciones son un momento para crear recuerdos inolvidables con seres queridos.

36. Itinuring nila itong kapamilya at nakatulong pa kay Roque sa pang-araw-araw na pahahanap ng pagkain.

37. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

38. The momentum of the rocket propelled it into space.

39. Les travailleurs indépendants travaillent souvent à leur propre compte.

40. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

41. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

42. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

43. Nanalo siya sa song-writing contest.

44. Hudyat iyon ng pamamahinga.

45. Sweetness can be balanced with other flavors to create a harmonious taste experience.

46. Les devises étrangères sont souvent utilisées dans les transactions internationales.

47. Nag-email na ako sayo kanina.

48. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

49. Ibinigay ng kumpanya ang malaking kawalan sa kanilang kita upang masiguro ang kaligtasan ng kanilang mga empleyado.

50. Kung alam ko lang na ganito kasakit ang magiging parusa ko

Recent Searches

nagpabayadkumikinigenergy-coalnakapagsabimuchakatawangnakasahodnangampanyamakakasahodmerlindapapagalitannagtrabahonananaghiliglobalisasyonibinubulonganibersaryobaguiobagopahirampoonglumuwasmakukulaymakakibomaisusuotdiwataarbejdsstyrketungkolkabutihanlumakiinjurymaliwanagmagkamalinakikitangpagdudugonaliwanaganinaaminuugod-ugodnapasigawbabasahinihahatidmahahalikuugud-ugodkapasyahanyouthbarung-barongpangarapdumatingformvitaminpatakbongkulunganbumababainuulammagsungitnabuhayuniversitysapatosyongkatutubonakatitigmanilbihanpananglawhulihanmaglarokapitbahaysenadorkinalakihanbalahibodesisyonanpagbabayadnapakagandabyggetskyldes,ngumingisivideosmalasmagtakatuwang-tuwadethatingayusinnatanongkadalasinlovedepartmenttsismosagarbansosbalikatpantalontinanggalmagbabalasementeryonewssiopaoano-anopwestovedvarendetherapeuticssilid-aralannagbagogawaingkesocover,umikottig-bebeintesinotwitchpasahekassingulangnaglababayanidescargarsasapakinmaya-mayaincitamenterkuligligfavorikatlongsabongkindergartenkoreamagkabilangpakistanisasamatindahanmbricoshumihingisusunodpadalaslabistamarawmaramottataaspampagandaligaliglittlemalawaklabahinhinukaycityhinanappayonglilikoampliamahigpiteffectisubotagalpalayonagniningningmanalokababalaghangkontramaghatinggabilifestocksricosurroundingsatensyondustpanrememberedpersonbobotomanilasadyanginintaydiseasenochepagdamiaregladobesestengabulongkambingperwisyotamadshoppingmabutihabitdiningsarongparoganunsumasaliwinventionomfattendecouldbagonge-commerce,admiredpalapagnanoodpatongallenatayoshadeshumigacoughingkapalinnovation