Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ipapaputol"

1. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

Random Sentences

1. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

2. Es importante tener amigos que nos apoyen y nos escuchen.

3. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

4. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

5. Pinapakain ng pulotgata ang mga langgam sa aming bakuran.

6. Have you eaten breakfast yet?

7. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

8. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

9. Babalik ako sa susunod na taon.

10. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

11. Naku di po ganun si Maico. automatic na sagot ko.

12. I am absolutely impressed by your talent and skills.

13. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

16. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

17. It was risky to climb the mountain during a thunderstorm.

18. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

19. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

20. Mahalagang alamin ang interes na ipinapataw ng utang upang malaman kung magkano ang babayaran na kabuuang halaga.

21. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

22. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

23. Ang pagkakaroon ng malalapit na kaibigan ay isang nakagagamot na karanasan.

24. La música es una parte importante de la

25. El uso de drogas es un problema grave en muchas sociedades.

26. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

27. Oo, kinanta 'to sakin ng isang babaeng kinaiinisan ko...

28. Ngumiti ako saka humalik sa mga labi niya.

29. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

30. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

31. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

32. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

33. La pobreza extrema puede llevar a la inseguridad alimentaria y la desnutrición.

34. Inutusan niya si Pinang na magluto ng lugaw.

35. Kung saan ka naroroon, doon ka maglingkod.

36. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

37. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

38. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

39. Nung natapos yung pag print, nakita nung babae yung pictures.

40. They are not running a marathon this month.

41. Kung gusto may paraan, kung ayaw may dahilan.

42. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

43. El agua es el recurso más preciado y debemos conservarlo.

44. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

45. Mi temperatura es alta. (My temperature is high.)

46. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

47. May limang estudyante sa klasrum.

48. nadama niya ang bagong tuklas na lakas niyon.

49. Hindi ako kumportable sa kanilang desisyon dahil mayroon akong mga katanungan kaya ako ay tumututol.

50. Einstein was known for his sense of humor and his love of sailing.

Recent Searches

taasipapaputoliilanasohdtvaabotpepenagdarasalpersonalbilinbarnesbatoburgerplacewestprimeranimoykadaratingitongcompostelatakesrailways1876utusanresearchhallamongagaprobablementeadverselyroboticmalagobumahamaalogsumasambaparanitongulamdapatspeedbarleegenerationerdidfistsfriesexperiencesconsideredagosyancompartendaanexampleideyainilingcomputereslaveoffentligmind:seenlimitimagingmagtagolabananyonnaggingpdaageferreripatuloyextrawaititemsprogramming,makapilingatingaffectstopandyelectedallowednicerobertpersistent,sinipangtumayonagpapasasaestasyonisinarapalasyozamboangatuluyangsakalingayonnanunurimakukulaymakakabalikdatakinikilalangabut-abotyouthpossiblepinangalanangvidtstraktkisapmatadireksyonnag-eehersisyoproduceunosdonsoccerpesohinukaymataaasnoonpa-dayagonalnationalmuchasyeloarawstorenakabasagnilutoresultpreviouslyanakdrawingfreelancermarangalkasuutanmagpa-picturesalu-salotinatawagikinakagalittaga-nayonpagsagotmakinangnakikitanghimihiyawalas-diyesgospelpilipinasamericabiyascualquiermahuhulinabiawanggamitinconclusion,xviipiyanosikatparaangandreaairplanesgrowthtilamamarilradiobritishbuhokfertilizermegetbienfeeltenbinabaanpapuntaenfermedades,heibelievedfuncionesnagkabungasantosinvolveagesidea:beforekaguluhanreturnedamountpilingimpactcurrentrememberworkshopdumalawnakabulagtangpinagmamalakinagpapaniwalanakikini-kinitastaplepaga-alalapagkakamalipagngitikasangkapanpagpapatubohinagud-hagodmakapaibabawnaglalatang