Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "movie"

1. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

2. Have we seen this movie before?

3. He is not watching a movie tonight.

4. He is watching a movie at home.

5. I have seen that movie before.

6. I just got around to watching that movie - better late than never.

7. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

8. Nagpapalabas ng horror movie ang TV network ngayong hatinggabi.

9. Nood tayong movie. maya-maya eh sabi niya.

10. The actor received a hefty fee for their role in the blockbuster movie.

11. The character in the movie was content in his simple life, believing that ignorance is bliss.

12. The movie was absolutely captivating from beginning to end.

13. The movie was rated R, and therefore she wasn't allowed to watch it.

14. The pretty lady in the movie stole the protagonist's heart.

15. They go to the movie theater on weekends.

16. They have been watching a movie for two hours.

Random Sentences

1. Det er vigtigt at have et støttende netværk af venner og familie under fødslen og i de første måneder efter fødslen.

2. Ilang kuwarto ho ang gusto niyo?

3. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

4. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

5. Kumusta ho ang pangangatawan niya?

6. She carefully layered the cake with alternating flavors of chocolate and vanilla.

7. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

8. Puwede ba akong sumakay ng dyipni?

9. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

10. Hindi dapat pagbasehan ang pagkatao ng isang tao sa kababawang mga bagay tulad ng panlabas na anyo.

11. Humahaba rin ang kaniyang buhok.

12. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

13. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

14. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

15. El error en la presentación está llamando la atención del público.

16. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

17. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

18. Pangako ng prinsipe kay Mariang maganda.

19. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

20. Hinugot niya ang kanyang bag sa ilalim ng mesa.

21. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

22. Masayang-masaya siguro ang lola mo, ano?

23. Nagtapos sya sa unibersidad ng Pilipinas.

24. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

25. He does not argue with his colleagues.

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. The garden boasts a variety of flowers, including roses and lilies.

28. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

29. She is not designing a new website this week.

30. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

31. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

32. Nagtawanan kaming lahat sa hinirit ni Kenji.

33. Påskelørdag er dagen, hvor Jesus lå i graven, og der afholdes ofte en stille og reflekterende gudstjeneste.

34. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

35. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

36. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

37. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

38. Ant-Man can shrink in size and communicate with ants using his helmet.

39. Nagpaluto ang nanay ko ng adobo sa akin.

40. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

41. She draws pictures in her notebook.

42. Siya ang pinuno ng rebolusyonaryong kilusan laban sa pananakop ng mga Espanyol.

43. Tanging ina lang at kapatid niya ang kanyang kasama

44. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

45. Ipanlinis mo ng sahig ang basahan.

46. Kulay itim ang libro ng kaklase ko.

47. Maliit lang ang kusina ni Lola Oliva.

48. Huh? Paanong it's complicated?

49. May pitong araw sa isang linggo.

50. Inakalang magaling na siya sa sakit, pero bumalik ang mga sintomas.

Similar Words

movies

Recent Searches

daramdaminmoviehitananlalamigbusinessesnakapilangibinigayjejuisinakripisyonapuyattumiranagsmiletumalimnalamanmagkasamadiintumamapakinabanganmagsisimulapoongberegningerrektanggulonakahainjeepneykaramihandiferentesnatitiyakkangitantinuturopaulit-ulitnalugodbumaligtadpinangalanankomunidadmalilimutanmatangumpayginavegaschristmasmabibingitagumpayreorganizingpigilanoueyoutubelarangantomorrowhongbirdseksportenaguakayoinnovationyunadvancetinikcompositoresvivadasalcomputersmissionpromotearteaudiencekasobawalandiconicriyanoutlinemulighedercarmenculturamagkaibigansiempregearrosawalngpangitbeganbeginningsokaydangeroussocialesilaymallisugabossnyafeltsweetydelserburgershiplugarstaplemapaikotvideomapuputitryghedwordschavitmaitimpakelamcommissionsagottuwidmalumbayinaloknalasingbinabaanemailellamagbungahan18thwellmapapaartificialdevicesobstaclesdonetwinklepinunitwealthspapandemyanagreklamoterminoguidebehaviortechnologiesactivityimprovedjunioleftnaglalabadrawingatingnakakagalingmangangahoyginugunitaipinagdiriwangmumuntingscaleicenagsasagotmagtatanimmapagkalingaipapahingamamahalinnahantadbilibidpalitankatolikocomforteveningpamamahingamusicianselectoralpamimilhingfeedback,paninginbugtongdalagangstudiedbitawannahihilonawalangbaonsiniyasatmakapaleskwelahanpadabogpinaghalopinaghihiwataga-ochandonakablueartisttagpiangdyosapulitikokamalayansakop3hrsalmacenarkamustasobrangwidelyibinalitangmamisumalareleasedscheduleyancomunicarsereallydistansyanakaramdamkayang-kayang