Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nabalitaan"

1. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

Random Sentences

1. Emphasis can be used to provide clarity and direction in writing.

2. Nandiyan po ba si Ginang de la Cruz?

3. We sang "happy birthday" to my nephew over video chat.

4. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

5. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

6. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

7. Daraan pa nga pala siya kay Taba.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. En invierno, los animales suelen hibernar para protegerse del clima frío.

10. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

11. Namnamin mo ang ganda ng paligid sa takipsilim.

12. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

13. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

14. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

15. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

16. All these years, I have been grateful for the opportunities that have come my way.

17. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

18. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

19. Salamat sa alok pero kumain na ako.

20. Amazon's Kindle e-reader is a popular device for reading e-books.

21. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

22. Air tenang menghanyutkan.

23. Limitations are the boundaries or constraints that restrict what one can or cannot do.

24. Bagaimana cara memperbaiki mesin cuci yang rusak? (How to fix a broken washing machine?)

25. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

26. Pagputi ng uwak, pag-itim ng tagak.

27. They are not shopping at the mall right now.

28. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

29. Limitations are the boundaries or constraints that restrict what one can or cannot do.

30. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

31. Scientific evidence suggests that global temperatures are rising due to human activity.

32. They play video games on weekends.

33. Bitte schön! - You're welcome!

34. Makikiraan po!

35. The dog barks at strangers.

36. Maari mo ba akong iguhit?

37. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

38.

39. Ano ang alagang hayop ng kapatid mo?

40. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

41. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

42. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

43. Ibinigay ko ang aking buong atensyon sa kanyang mga salita upang maunawaan ang kanyang mga kahilingan.

44. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

45. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

46. No hay mal que por bien no venga.

47. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

48. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

49. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

50. Mahusay gumawa ng bahay ang kanyang tatay.

Recent Searches

nabalitaankasalukuyannamumuongpagkakapagsalitasasagutinnagpalalimnagpuyosnaglakadinilalabaseskuwelatatawagnagsasagotcultivarpangangatawanuusapannakuhanapagtantokalalaromaghahatidnagliwanagkapamilyanaapektuhanlumakitanggalinmedicinemagkasamakayabangannamataymagtagonaglulutomagtatanimumiyakkatutuboartisttagaytaykinalilibingannapakabilisnagbabalanakakaanimkapitbahaynakalocksiguradopakinabangankaraokemagkikitakaratulangcosechar,kapatagannagpasamanabasakinakainmahalnagsamastoredaratingsahodnauntogmaibigaygawingbutterflypinilititinaobpagpalitnakakaenespigasinfluenceshotelmaatimmusiciansbumuhosthroatbumangonsandalingipagtanggolmalumbaypaksatsupernapatinginipinasyangreviewsusulitdesarrollarmarteskabosespanobasahinpalagireachadicionalespriestvehiclesnahuliinantoksinunodpartylayasbernardoeffektivkadaratingbukodcoaching:yesreducedcuentanmisuseddinalawdraybermuligheddisappointcultivaactingkartonideaoutpostsumangforceselectionpromotingadditionallyalmacenarnagpasyanag-bookevenmarkedmonetizingnaiinggitipinabitawanstudiedoffentligstylesregularmenteconsiderilingmappaggawaprogramming,maratingnganoonsurgerymaliliittonybakitmatamanunconstitutionalnakakapuntapatuloytinayhalu-halocharismaticboseshudyatconsiderarpanahondireksyontulangjobslassiguromatataloeitheripinauutangnakalilipashumalolagnattandangfollowinglongtaksinagbibigayipinambilipakisabipartsracialmatitigasdahilagilamagtipidtonightbathalabagokasiluissearchhalikaconvertingestadoskanserduonprincehidingloansfueldaladalatiketblazingdiagnosticdulotpopularize