Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "abundante"

1. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

Random Sentences

1. Wala ho akong kinukuha sa inyong pitaka.

2.

3. El arte puede ser interpretado de diferentes maneras por diferentes personas.

4. Saan ho ba ang papuntang Manila Hotel?

5. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

6. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

7. The charitable organization provides free medical services to remote communities.

8. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. Namnamin mo ang halik ng malamig na hangin sa umaga.

11. Tuwing mayo kung ganapin ang eleksyon.

12. Naaksidente si Juan sa Katipunan

13. Ang tarangkahan ng aming tahanan ay kulay pula.

14. Entschuldigung. - Excuse me.

15. I was going to surprise her, but I accidentally spilled the beans.

16. Makikita mo sa google ang sagot.

17. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

18. The United States is a federal republic consisting of 50 states, a federal district, and five major self-governing territories.

19. Bigyan mo ng pera ang kapatid mo.

20. Nagkwento ang lolo tungkol sa multo.

21. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

22. They are singing a song together.

23. Magandang Umaga!

24. Malilimutin siya sa mga pangalan ng tao kaya’t lagi siyang nahihiya sa pakikisalamuha.

25. The task of organizing the event was quite hefty, but we managed to pull it off.

26. If you don't want me to spill the beans, you'd better tell me the truth.

27. Sadyang mahirap ang pag-aaral ng calculus.

28. Ngunit kahit ganyan ang kinalalagyan.

29. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

30. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

31. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

32. Lazada has a strong focus on customer service and has won awards for its efforts.

33. Nang maglalabing anim na taon na si Rabona ay may nakita siyang isang pusa sa kagubatan.

34. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

35. A quien madruga, Dios le ayuda. - The early bird catches the worm.

36. Ang gobyerno ay naglaan ng tulong para sa mga apektado ng tagtuyot.

37. Napapikit ako at naglabas ng malalim na himutok upang maibsan ang aking pagod.

38. Bakit? sabay harap niya sa akin

39. Hindi na nakita ni Aling Rosa si Pinang.

40. From there it spread to different other countries of the world

41. Ano ang nangyari sa Compostela Valley?

42. Itinago ni Luz ang libro sa aparador.

43. El cultivo de hortalizas es fundamental para una alimentación saludable.

44. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

45. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

46. Nang malamang hindi ako makakapunta sa pangarap kong bakasyon, naglabas ako ng malalim na himutok.

47. Skolegang er en vigtig del af børns opvækst og udvikling.

48. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

49. Kapag may isinuksok, may madudukot.

50. Este año espero cosechar una buena cantidad de tomates de mi huerto.

Recent Searches

hayaangpakikipagbabagabundantetootangeksnalamanlubosnagbanggaanpagkuwaconsumena-fundcarebahagyahumiwalaypinag-aralantuluyansementongkonsentrasyonsaansorrymayabangokaytransportpeer-to-peerkinagalitanilogbetatabasgumagamitmagpapigilmagdamagnaglokoframagtatakasalbahepamahalaankailanexhaustionrenatotaksiperowaiterdiyanmasasarappumayagabonounattendedkahirapanartsrobertadicionalesaganatanggapipatuloyemphasisanaypublicity1954tignanlikelytayoalas-dostiningnanproducirelviskaarawannasundomotiondividedrepresentedtungawnagniningningneverdepartmentkasalnagplaytakespunsomisusedmagbubungatusindvispatrickbasahantagalogyeahtaga-suportatabingmahigpitvelfungerendenegativeminamasdandapit-haponngpuntawaitsagappdanapapahintomemoprogressprimerpshideapossiblelasingauthorcallingmenubeyondallowedoperativostradisyonprogramspaalamnapagsilbihanmeansmatutongbutterflybilihinspeede-commerce,maatimmakikiligoqualityso-calledpumuntalintadependingkinabukasanpalakapagkakamalayanpang-araw-arawnamilipitpupuntasisterkamayiba-ibangnakaka-intutusinnatitirangtherapyresponsibledeathnilayuanhinawakanalas-dosedatapwattumutubopuntahankalaunanbumagsakkaraokekarangalandesarrollaramericanmeriendamagpa-checkupandresbook,individualperseverance,magbigayansiksikanpamasaheydelseraraw-kasamatugonkwebakabuntisanpadabogmetodisksabermonsignorkontingbritishmamarilyeykananbakenegro-slaveshetonapakalargerarawcourtnakahugpasalamatanpulitikoboymalayabutasmatanggapnagkapilathesukristobentahanindiamasiyadobanyokinabibilangan